tumor suppressor p53

General Information (Source: NCBI Gene,UniProt)

Text mining Term tumor suppressor p53
UniProt ID Q549C9_MOUSE
Name Cellular tumor antigen p53
Gene Names Trp53
Synonyms:p53
Taxonomy Mus musculus

General annotation

Function Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression (By similarity).
Subcellular location Cytoplasm. Nucleus (By similarity).

Gene Ontology

GO:0006302 double-strand break repair BP
GO:0002309 T cell proliferation involved in immune response BP
GO:0007369 gastrulation BP
GO:0002326 B cell lineage commitment BP
GO:0043525 positive regulation of neuron apoptosis BP
GO:0051262 protein tetramerization BP
GO:0033077 T cell differentiation in thymus BP
GO:0008156 negative regulation of DNA replication BP
GO:0000060 protein import into nucleus, translocation BP
GO:0043066 negative regulation of apoptotic process BP
GO:0009303 rRNA transcription BP
GO:0002360 T cell lineage commitment BP
GO:0001756 somitogenesis BP
GO:0000122 negative regulation of transcription from RNA polymerase II promoter BP
GO:0010165 response to X-ray BP
GO:0034644 cellular response to UV BP
GO:0007417 central nervous system development BP
GO:0051276 chromosome organization BP
GO:0035264 multicellular organism growth BP
GO:0001701 in utero embryonic development BP
GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway BP
GO:0043565 sequence-specific DNA binding MF
GO:0003682 chromatin binding MF
GO:0007406 negative regulation of neuroblast proliferation BP
GO:0048147 negative regulation of fibroblast proliferation BP
GO:0046902 regulation of mitochondrial membrane permeability BP
GO:0006978 DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator BP
GO:0005739 mitochondrion CC
GO:0002039 p53 binding MF
GO:0042771 DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis BP
GO:0005657 replication fork CC
GO:0006977 DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest BP
GO:0035033 histone deacetylase regulator activity MF
GO:0001836 release of cytochrome c from mitochondria BP
GO:0031065 positive regulation of histone deacetylation BP
GO:0010332 response to gamma radiation BP
GO:0003684 damaged DNA binding MF
GO:0001077 RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription MF
GO:0005829 cytosol CC

Sequence

>gi|148747262|ref|NP_035770.2| cellular tumor antigen p53 isoform a [Mus musculus]
MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRVSGAPAAQ
DPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPV
QLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFR
HSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRR
TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDA
HATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD

Options for BLAST

Database:

Set subsequence:(optional):
From: To:

Optional parameters:
Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSMUST00000108658
UniGene Mm.222
PDB
RefSeq NP_035770.2
Pfam PF08563
PF00870
PF07710