tumor suppressor p53

General Information (Source: NCBI Gene,UniProt)

Text mining Term	tumor suppressor p53
UniProt ID	P53_MOUSE
Name	Cellular tumor antigen p53 Tumor suppressor p53
Gene Names	Tp53
Taxonomy	Mus musculus

General annotation

Function	Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression (By similarity).
Subcellular location	Cytoplasm (By similarity). Nucleus (By similarity). Endoplasmic reticulum (By similarity). Nucleus, PML body (By similarity). Note=Interaction with BANP promotes nuclear localization. Recruited into PML bodies together with CHEK2 (By similarity).

Function

Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression (By similarity).

Subcellular location

Cytoplasm (By similarity). Nucleus (By similarity). Endoplasmic reticulum (By similarity). Nucleus, PML body (By similarity). Note=Interaction with BANP promotes nuclear localization. Recruited into PML bodies together with CHEK2 (By similarity).

Gene Ontology

GO:0003682	chromatin binding	MF
GO:0000060	protein import into nucleus, translocation	BP
GO:0001701	in utero embryonic development	BP
GO:0010332	response to gamma radiation	BP
GO:0009303	rRNA transcription	BP
GO:0000785	chromatin	CC
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	BP
GO:0002360	T cell lineage commitment	BP
GO:0043525	positive regulation of neuron apoptosis	BP
GO:0005524	ATP binding	MF
GO:0016605	PML body	CC
GO:0005657	replication fork	CC
GO:0051262	protein tetramerization	BP
GO:0030308	negative regulation of cell growth	BP
GO:0090343	positive regulation of cell aging	BP
GO:0008340	determination of adult lifespan	BP
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	BP
GO:0002309	T cell proliferation involved in immune response	BP
GO:0070245	positive regulation of thymocyte apoptosis	BP
GO:0005730	nucleolus	CC
GO:0006289	nucleotide-excision repair	BP
GO:0000739	DNA strand annealing activity	MF
GO:0007049	cell cycle	BP
GO:0001756	somitogenesis	BP
GO:0008635	activation of caspase activity by cytochrome c	BP
GO:0035264	multicellular organism growth	BP
GO:0005739	mitochondrion	CC
GO:0044212	transcription regulatory region DNA binding	MF
GO:0006302	double-strand break repair	BP
GO:0002326	B cell lineage commitment	BP
GO:0046902	regulation of mitochondrial membrane permeability	BP
GO:0001077	RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription	MF
GO:0031065	positive regulation of histone deacetylation	BP
GO:0005783	endoplasmic reticulum	CC
GO:0051276	chromosome organization	BP
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	BP
GO:0035033	histone deacetylase regulator activity	MF
GO:0048147	negative regulation of fibroblast proliferation	BP
GO:0008156	negative regulation of DNA replication	BP
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	BP
GO:0042771	DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis	BP
GO:0006978	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	BP
GO:0043565	sequence-specific DNA binding	MF
GO:0005507	copper ion binding	MF
GO:0007569	cell aging	BP
GO:0007417	central nervous system development	BP
GO:0003684	damaged DNA binding	MF
GO:0001836	release of cytochrome c from mitochondria	BP
GO:0010165	response to X-ray	BP
GO:0007369	gastrulation	BP
GO:0043066	negative regulation of apoptotic process	BP
GO:0033077	T cell differentiation in thymus	BP
GO:0042493	response to drug	BP
GO:0005829	cytosol	CC
GO:0007406	negative regulation of neuroblast proliferation	BP
GO:0005667	transcription factor complex	CC
GO:0034644	cellular response to UV	BP
GO:0002039	p53 binding	MF
GO:0070215	MDM2 binding	MF

Sequence

>gi|187960040|ref|NP_001120705.1| cellular tumor antigen p53 isoform b [Mus musculus]
MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRVSGAPAAQ
DPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPV
QLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFR
HSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRR
TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDA
HATEESGDSRAHSSLQPRAFQALIKEESPNC

Database Cross Reference

Ensembl Gene	ENSMUST00000005371
UniGene	Mm.222
PDB	2IOM 3EXL 2P52 3EXJ 2IOO 1HU8 2IOI 2GEQ
RefSeq	NP_001120705.1 NP_035770.2
Pfam	PF07710 PF08563 PF00870

PTID

tumor suppressor p53

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference