P14

General Information (Source: NCBI Gene,UniProt)

Text mining Term	P14
UniProt ID	S10A9_RAT
Name	Myeloid-related protein 14 MRP-14 Migration inhibitory factor-related protein 14 Calgranulin-B p14 Protein S100-A9 S100 calcium-binding protein A9
Gene Names	S100a9 Synonyms:Mrp14
Taxonomy	Rattus norvegicus

General annotation

Function	Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS). Promotes tubulin polymerization when unphosphorylated. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as pro- inflammatory mediator in acute and chronic inflammation and up- regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions (By similarity). Stimulates proliferation of fibroblast cells as both a monomer and a homodimer. May act as a mitogen during chronic inflammation.
Subcellular location	Secreted (By similarity). Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Peripheral membrane protein (By similarity). Note=Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM- CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes (By similarity).

Function

Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS). Promotes tubulin polymerization when unphosphorylated. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as pro- inflammatory mediator in acute and chronic inflammation and up- regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions (By similarity). Stimulates proliferation of fibroblast cells as both a monomer and a homodimer. May act as a mitogen during chronic inflammation.

Subcellular location

Secreted (By similarity). Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Peripheral membrane protein (By similarity). Note=Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM- CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes (By similarity).

Gene Ontology

GO:0032496	response to lipopolysaccharide	BP
GO:0045471	response to ethanol	BP
GO:0005886	plasma membrane	CC
GO:0005509	calcium ion binding	MF
GO:0005737	cytoplasm	CC
GO:0005615	extracellular space	CC
GO:0005856	cytoskeleton	CC
GO:0002544	chronic inflammatory response	BP
GO:0010043	response to zinc ion	BP

Sequence

>gi|16758364|ref|NP_446039.1| protein S100-A9 [Rattus norvegicus]
MAAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTN
QDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHRHGKGCGK

Database Cross Reference

Ensembl Gene	ENSRNOT00000015351
UniGene	Rn.6703
PDB
RefSeq	NP_446039.1
Pfam	PF01023

PTID

P14

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference