Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
Brain-derived neurotrophic factor BDNF |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0055093 | response to hyperoxia | BP |
GO:0030182 | neuron differentiation | BP |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
GO:0002544 | chronic inflammatory response | BP |
GO:0001666 | response to hypoxia | BP |
GO:0014076 | response to fluoxetine | BP |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0009725 | response to hormone stimulus | BP |
GO:0072347 | response to anesthetic | BP |
GO:0033189 | response to vitamin A | BP |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
GO:0008021 | synaptic vesicle | CC |
GO:0042493 | response to drug | BP |
GO:0008083 | growth factor activity | MF |
GO:0050890 | cognition | BP |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0005576 | extracellular region | CC |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |