Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
BDNF Brain-derived neurotrophic factor |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0014076 | response to fluoxetine | BP |
GO:0008021 | synaptic vesicle | CC |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
GO:0002544 | chronic inflammatory response | BP |
GO:0055093 | response to hyperoxia | BP |
GO:0050890 | cognition | BP |
GO:0008083 | growth factor activity | MF |
GO:0072347 | response to anesthetic | BP |
GO:0033189 | response to vitamin A | BP |
GO:0009725 | response to hormone stimulus | BP |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0030182 | neuron differentiation | BP |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0042493 | response to drug | BP |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
GO:0001666 | response to hypoxia | BP |
GO:0005576 | extracellular region | CC |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |