Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
Brain-derived neurotrophic factor BDNF |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
GO:0042493 | response to drug | BP |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
GO:0030182 | neuron differentiation | BP |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0014076 | response to fluoxetine | BP |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
GO:0055093 | response to hyperoxia | BP |
GO:0008083 | growth factor activity | MF |
GO:0008021 | synaptic vesicle | CC |
GO:0001666 | response to hypoxia | BP |
GO:0002544 | chronic inflammatory response | BP |
GO:0033189 | response to vitamin A | BP |
GO:0050890 | cognition | BP |
GO:0005576 | extracellular region | CC |
GO:0009725 | response to hormone stimulus | BP |
GO:0072347 | response to anesthetic | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |