Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
Brain-derived neurotrophic factor BDNF |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0008083 | growth factor activity | MF |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
GO:0050890 | cognition | BP |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0002544 | chronic inflammatory response | BP |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0055093 | response to hyperoxia | BP |
GO:0009725 | response to hormone stimulus | BP |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
GO:0072347 | response to anesthetic | BP |
GO:0014076 | response to fluoxetine | BP |
GO:0030182 | neuron differentiation | BP |
GO:0005576 | extracellular region | CC |
GO:0001666 | response to hypoxia | BP |
GO:0042493 | response to drug | BP |
GO:0008021 | synaptic vesicle | CC |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0033189 | response to vitamin A | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |