P25

General Information (Source: NCBI Gene,UniProt)

Text mining Term	P25
UniProt ID	NGAL_RAT
Name	NGAL Neutrophil gelatinase-associated lipocalin p25 Alpha-2U globulin-related protein Alpha-2-microglobulin-related protein Lipocalin-2
Gene Names	Lcn2
Taxonomy	Rattus norvegicus

General annotation

Function	Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. Binds iron through association with 2,5-dihydroxybenzoic acid (2,5- DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth (By similarity).
Subcellular location	Secreted (By similarity). Note=Upon binding to the SLC22A17 (24p3R) receptor, it is internalized (By similarity).

Function

Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. Binds iron through association with 2,5-dihydroxybenzoic acid (2,5- DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth (By similarity).

Subcellular location

Secreted (By similarity). Note=Upon binding to the SLC22A17 (24p3R) receptor, it is internalized (By similarity).

Gene Ontology

GO:0015891	siderophore transport	BP
GO:0071356	cellular response to tumor necrosis factor	BP
GO:0042981	regulation of apoptotic process	BP
GO:0042803	protein homodimerization activity	MF
GO:0071222	cellular response to lipopolysaccharide	BP
GO:0010628	positive regulation of gene expression	BP
GO:0005506	iron ion binding	MF
GO:0070207	protein homotrimerization	BP
GO:0006915	apoptotic process	BP
GO:0031346	positive regulation of cell projection organization	BP
GO:0002020	protease binding	MF
GO:0005615	extracellular space	CC
GO:0070301	cellular response to hydrogen peroxide	BP
GO:0005215	transporter activity	MF
GO:0071347	cellular response to interleukin-1	BP
GO:0045087	innate immune response	BP
GO:0031669	cellular response to nutrient levels	BP
GO:0009635	response to herbicide	BP
GO:0005829	cytosol	CC
GO:0042493	response to drug	BP

Sequence

>gi|18543345|ref|NP_570097.1| neutrophil gelatinase-associated lipocalin precursor [Rattus norvegicus]
MGLGVLCLALVLLGVLQRQAQDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAANAVQKERQSRFT
MYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAM
VFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN

Database Cross Reference

Ensembl Gene	ENSRNOT00000018776
UniGene	Rn.11303
PDB	2K23
RefSeq	NP_570097.1
Pfam	PF00061

PTID

P25

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference