Text mining Term | H ras |
---|---|
UniProt ID | RAS1_DROME |
Name |
Dras1 Dmras85D Ras-like protein 1 |
Gene Names |
Ras85D
Synonyms:Ras1 |
Taxonomy | Drosophila melanogaster |
Function |
May mediate a signal that determines the fate of photoreceptor cells in the developing compound eye. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. |
---|---|
Subcellular location |
Cell membrane; Lipid-anchor; Cytoplasmic side. Note=Loss of prenylation causes protein location to the cytoplasm. |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0007428 | primary branching, open tracheal system | BP |
GO:0045610 | regulation of hemocyte differentiation | BP |
GO:0008293 | torso signaling pathway | BP |
GO:0045500 | sevenless signaling pathway | BP |
GO:0007391 | dorsal closure | BP |
GO:0006916 | anti-apoptosis | BP |
GO:0035088 | establishment or maintenance of apical/basal cell polarity | BP |
GO:0008361 | regulation of cell size | BP |
GO:0007369 | gastrulation | BP |
GO:0035099 | hemocyte migration | BP |
GO:0007298 | border follicle cell migration | BP |
GO:0006606 | protein import into nucleus | BP |
GO:0016049 | cell growth | BP |
GO:0003924 | GTPase activity | MF |
GO:0008284 | positive regulation of cell proliferation | BP |
GO:0007426 | tracheal outgrowth, open tracheal system | BP |
GO:0007507 | heart development | BP |
GO:0030381 | chorion-containing eggshell pattern formation | BP |
GO:0007422 | peripheral nervous system development | BP |
GO:0008595 | anterior/posterior axis specification, embryo | BP |
GO:0005525 | GTP binding | MF |
GO:0072089 | stem cell proliferation | BP |
GO:0007309 | oocyte axis specification | BP |
GO:0007476 | imaginal disc-derived wing morphogenesis | BP |
GO:0005886 | plasma membrane | CC |
GO:0046534 | positive regulation of photoreceptor cell differentiation | BP |
GO:0040014 | regulation of multicellular organism growth | BP |
GO:0000082 | G1/S transition of mitotic cell cycle | BP |
GO:0002168 | instar larval development | BP |
GO:0072002 | Malpighian tubule development | BP |
GO:0001708 | cell fate specification | BP |
GO:0030307 | positive regulation of cell growth | BP |
GO:0007455 | eye-antennal disc morphogenesis | BP |
GO:0046673 | negative regulation of compound eye retinal cell programmed cell death | BP |
GO:0048863 | stem cell differentiation | BP |
>gi|131859|sp|P08646.2|RAS1_DROME RecName: Full=Ras-like protein 1; Short=Dras1; AltName: Full=Dmras85D; Flags: Precursor MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ YMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASWNVNNEQAREVAKQYGIP YIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNKPNRRFKCKML |
Ensembl Gene | |
---|---|
UniGene |
Dm.4812 |
PDB | |
RefSeq |
NP_476699.1 |
Pfam |
PF00071 |