Text mining Term | protein is |
---|---|
UniProt ID | PSBI_IPOPU |
Name |
PSII 4.8 kDa protein PSII-I Photosystem II reaction center protein I |
Gene Names |
psbI
|
Taxonomy | Ipomoea purpurea |
Function |
This protein is a component of the reaction center of photosystem II (By similarity). |
---|---|
Subcellular location |
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein (By similarity). |
GO:0009539 | photosystem II reaction center | CC |
GO:0015979 | photosynthesis | BP |
GO:0016021 | integral to membrane | CC |
GO:0009535 | chloroplast thylakoid membrane | CC |
>gi|212277646|sp|A7Y3A3.1|PSBI_IPOPU RecName: Full=Photosystem II reaction center protein I; Short=PSII-I; AltName: Full=PSII 4.8 kDa protein MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq |
YP_001468292.1 |
Pfam |
PF02532 |