| Text mining Term | ATPase |
|---|---|
| UniProt ID | ATPH_HELAN |
| Name |
F-ATPase subunit c ATP synthase F(0) sector subunit c ATP synthase subunit c, chloroplastic ATPase subunit III Lipid-binding protein F-type ATPase subunit c |
| Gene Names |
atpH
|
| Taxonomy | Helianthus annuus |
| Function |
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (By similarity).
Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits (By similarity). |
|---|---|
| Subcellular location |
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein (By similarity). |
| GO:0015991 | ATP hydrolysis coupled proton transport | BP |
| GO:0008289 | lipid binding | MF |
| GO:0009535 | chloroplast thylakoid membrane | CC |
| GO:0015078 | hydrogen ion transmembrane transporter activity | MF |
| GO:0045263 | proton-transporting ATP synthase complex, coupling factor F(o) | CC |
| GO:0016021 | integral to membrane | CC |
| GO:0015986 | ATP synthesis coupled proton transport | BP |
>gi|122225260|sp|Q1KXW7.1|ATPH_HELAN RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVV ALALLFANPFV |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq |
YP_588109.1 |
| Pfam |
PF00137 |