Text mining Term | albumin |
---|---|
UniProt ID | 2SS_TAROF |
Name |
2S albumin large chain 2S albumin 2S albumin small chain To-A1 |
Gene Names |
|
Taxonomy | Taraxacum officinale |
Function |
This is a 2S seed storage protein. Has antifungal activity. Inhibits spore germination in H.sativum (IC(50)=62.5 ug/ml) and P.betae (IC(50)=62.5 ug/ml). Inhibits growth of H.sativum, V.albo-atrum and P.infestans. |
---|---|
Subcellular location |
GO:0031640 | killing of cells of other organism | BP |
GO:0045735 | nutrient reservoir activity | MF |
GO:0002229 | defense response to oomycetes | BP |
GO:0050832 | defense response to fungus | BP |
>gi|308189456|sp|P86783.1|2SS_TAROF RecName: Full=2S albumin; AltName: Full=To-A1; Contains: RecName: Full=2S albumin small chain; Contains: RecName: Full=2S albumin large chain PVSRQQCSQRIQGERFNQCRSQMQDGQLQSCCQELQNVEEQCQC |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |