endothelin 1

General Information (Source: NCBI Gene,UniProt)

Text mining Term endothelin 1
UniProt ID Q544E0_MOUSE
Name Preproendothelin
Gene Names Edn1
Synonyms:preproET
Taxonomy Mus musculus

General annotation

Function
Subcellular location

Gene Ontology

GO:0005615 extracellular space CC
GO:0007589 body fluid secretion BP
GO:0009953 dorsal/ventral pattern formation BP
GO:0007585 respiratory gaseous exchange BP
GO:0006885 regulation of pH BP
GO:0001569 patterning of blood vessels BP
GO:0031583 activation of phospholipase D activity by G-protein coupled receptor protein signaling pathway BP
GO:0007205 activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway BP
GO:0001701 in utero embryonic development BP
GO:0031707 endothelin A receptor binding MF
GO:0051216 cartilage development BP
GO:0019229 regulation of vasoconstriction BP
GO:0014032 neural crest cell development BP
GO:0043179 rhythmic excitation BP
GO:0030818 negative regulation of cAMP biosynthetic process BP
GO:0042474 middle ear morphogenesis BP
GO:0035810 positive regulation of urine volume BP
GO:0051482 elevation of cytosolic calcium ion concentration involved in G-protein signaling coupled to IP3 second messenger BP
GO:0001666 response to hypoxia BP
GO:0015758 glucose transport BP
GO:0007507 heart development BP
GO:0035815 positive regulation of renal sodium excretion BP

Sequence

>gi|6753720|ref|NP_034234.1| endothelin-1 precursor [Mus musculus]
MDYFPVIFSLLFVTFQGAPETAVLGAELSTGAENGVQSPPPSTPWRPRRSKRCSCSSLMDKECVYFCHLD
IIWVNTPERVVPYGLGGSSRSKRSLKDLLPNKATDQAVRCQCAHQKDKKCWNFCQAGKELRAQSTMQKSL
KDSKKGKPCSKLGKKCIYQQLVEGRKLRRLEAISNSIKASFRVAKLKAELYRDQKLTHNRAH

Options for BLAST

Database:

Set subsequence:(optional):
From: To:

Optional parameters:
Expect:
Descriptions:

Database Cross Reference

Ensembl Gene
UniGene Mm.14543
PDB
RefSeq NP_034234.1
Pfam PF00322