| Text mining Term | corticotropin releasing factor |
|---|---|
| UniProt ID | CRF_RAT |
| Name |
Corticotropin-releasing factor Corticoliberin CRF Corticotropin-releasing hormone |
| Gene Names |
Crh
|
| Taxonomy | Rattus norvegicus |
| Function |
This hormone from hypothalamus regulates the release of corticotropin from pituitary gland. |
|---|---|
| Subcellular location |
Secreted. |
| GO:0051412 | response to corticosterone stimulus | BP |
| GO:0033494 | ferulate metabolic process | BP |
| GO:0045471 | response to ethanol | BP |
| GO:0035774 | positive regulation of insulin secretion involved in cellular response to glucose stimulus | BP |
| GO:0051430 | corticotropin-releasing hormone receptor 1 binding | MF |
| GO:0042493 | response to drug | BP |
| GO:0001934 | positive regulation of protein phosphorylation | BP |
| GO:0007616 | long-term memory | BP |
| GO:0051431 | corticotropin-releasing hormone receptor 2 binding | MF |
| GO:0008284 | positive regulation of cell proliferation | BP |
| GO:0042220 | response to cocaine | BP |
| GO:0045776 | negative regulation of blood pressure | BP |
| GO:0043025 | neuronal cell body | CC |
| GO:0007631 | feeding behavior | BP |
| GO:0050801 | ion homeostasis | BP |
| GO:0045472 | response to ether | BP |
| GO:0008628 | induction of apoptosis by hormones | BP |
| GO:0060548 | negative regulation of cell death | BP |
| GO:0090280 | positive regulation of calcium ion import | BP |
| GO:0043627 | response to estrogen stimulus | BP |
| GO:0035902 | response to immobilization stress | BP |
| GO:0016101 | diterpenoid metabolic process | BP |
| GO:0010628 | positive regulation of gene expression | BP |
| GO:0048265 | response to pain | BP |
| GO:0060456 | positive regulation of digestive system process | BP |
| GO:0071549 | cellular response to dexamethasone stimulus | BP |
| GO:0005737 | cytoplasm | CC |
| GO:0051461 | positive regulation of corticotropin secretion | BP |
| GO:0032811 | negative regulation of epinephrine secretion | BP |
| GO:0008306 | associative learning | BP |
| GO:0010700 | negative regulation of norepinephrine secretion | BP |
| GO:2000987 | positive regulation of behavioral fear response | BP |
| GO:0014062 | regulation of serotonin secretion | BP |
| GO:0043526 | neuroprotection | BP |
| GO:2000854 | positive regulation of corticosterone secretion | BP |
| GO:0021854 | hypothalamus development | BP |
| GO:0010629 | negative regulation of gene expression | BP |
| GO:0005615 | extracellular space | CC |
| GO:0033685 | negative regulation of luteinizing hormone secretion | BP |
| GO:0030819 | positive regulation of cAMP biosynthetic process | BP |
| GO:0070093 | negative regulation of glucagon secretion | BP |
| GO:0017045 | corticotropin-releasing hormone activity | MF |
>gi|13591920|ref|NP_112281.1| corticoliberin precursor [Rattus norvegicus] MRLRLLVSAGMLLVALSPCLPCRALLSRGSVSGAPRAPQPLNFLQPEQPQQPQPILIRMGEEYFLRLGNL NRSPAARLSPNSTPLTAGRGSRPSHDQAAANFFRVLLQQLQMPQRPLDSSTELAERGAEDALGGHQGALE RERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK |
| Ensembl Gene |
ENSRNOT00000016953 |
|---|---|
| UniGene |
Rn.10349 |
| PDB | |
| RefSeq |
NP_112281.1 |
| Pfam |
PF00473 |