Text mining Term | arginine vasopressin |
---|---|
UniProt ID | NEU2_RAT |
Name |
Copeptin AVP-NPII Arg-vasopressin Vasopressin-neurophysin 2-copeptin Neurophysin 2 Neurophysin-I |
Gene Names |
Avp
|
Taxonomy | Rattus norvegicus |
Function |
Neurophysin 2 specifically binds vasopressin.
Vasopressin has a direct antidiuretic action on the kidney, it also causes vasoconstriction of the peripheral vessels. |
---|---|
Subcellular location |
Secreted. |
GO:0005185 | neurohypophyseal hormone activity | MF |
GO:0007625 | grooming behavior | BP |
GO:0007626 | locomotory behavior | BP |
GO:0007204 | elevation of cytosolic calcium ion concentration | BP |
GO:0035094 | response to nicotine | BP |
GO:0042711 | maternal behavior | BP |
GO:0031894 | V1A vasopressin receptor binding | MF |
GO:0002125 | maternal aggressive behavior | BP |
GO:0030307 | positive regulation of cell growth | BP |
GO:0035813 | regulation of renal sodium excretion | BP |
GO:0045471 | response to ethanol | BP |
GO:0031895 | V1B vasopressin receptor binding | MF |
GO:0032849 | positive regulation of cellular pH reduction | BP |
GO:0001659 | temperature homeostasis | BP |
GO:0014049 | positive regulation of glutamate secretion | BP |
GO:0031896 | V2 vasopressin receptor binding | MF |
GO:0005615 | extracellular space | CC |
GO:0043084 | penile erection | BP |
GO:0006939 | smooth muscle contraction | BP |
GO:0003084 | positive regulation of systemic arterial blood pressure | BP |
GO:0008284 | positive regulation of cell proliferation | BP |
GO:0050891 | multicellular organismal water homeostasis | BP |
GO:0030425 | dendrite | CC |
GO:0042538 | hyperosmotic salinity response | BP |
GO:0007621 | negative regulation of female receptivity | BP |
GO:0035176 | social behavior | BP |
GO:0045907 | positive regulation of vasoconstriction | BP |
GO:0030141 | secretory granule | CC |
GO:0042310 | vasoconstriction | BP |
GO:0031394 | positive regulation of prostaglandin biosynthetic process | BP |
GO:0051970 | negative regulation of transmission of nerve impulse | BP |
>gi|291327518|ref|NP_058688.2| vasopressin-neurophysin 2-copeptin preproprotein [Rattus norvegicus] MLAMMLNTTLSACFLSLLALTSACYFQNCPRGGKRATSDMELRQCLPCGPGGKGRCFGPSICCADELGCF LGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSDESCVAEPECREGFFRLTRAREQSNATQLD GPARELLLRLVQLAGTQESVDSAKPRVY |
Ensembl Gene |
ENSRNOT00000028833 |
---|---|
UniGene |
Rn.9976 |
PDB | |
RefSeq |
NP_058688.2 |
Pfam |
PF00184 PF00220 |