factor A

General Information (Source: NCBI Gene,UniProt)

Text mining Term factor A
UniProt ID GSK3B_RAT
Name FA
GSK-3 beta
Serine/threonine-protein kinase GSK3B
Factor A
Glycogen synthase kinase-3 beta
Gene Names Gsk3b
Taxonomy Rattus norvegicus

General annotation

Function Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), EIF2B, CTNNB1/beta-catenin, APC, AXIN1, JUN, NFATC1/NFATC, MAPT/TAU and MACF1. Requires primed phosphorylation of the majority of its substrates. In skeletal muscle, contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. May also mediate the development of insulin resistance by regulating activation of transcription factors. Regulates protein synthesis by controlling the activity of initiation factor 2B (EIF2BE/EIF2B5) in the same manner as glycogen synthase. In Wnt signaling, GSK3B forms a multimeric complex with APC, AXIN1 and CTNNB1/beta-catenin and phosphorylates the N-terminus of CTNNB1 leading to its degradation mediated by ubiquitin/proteasomes. Phosphorylates JUN at sites proximal to its DNA-binding domain, thereby reducing its affinity for DNA. Phosphorylates NFATC1/NFATC on conserved serine residues promoting NFATC1/NFATC nuclear export, shutting off NFATC1/NFATC gene regulation, and thereby opposing the action of calcineurin. Phosphorylates MAPT/TAU on 'Thr-548', decreasing significantly MAPT/TAU ability to bind and stabilize microtubules. Plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. Phosphorylates MACF1, inhibiting its binding to microtubules which is critical for its role in bulge stem cell migration and skin wound repair. Probably regulates NF-kappa-B (NFKB1) at the transcriptional level and is required for the NF-kappa-B-mediated anti-apoptotic response to TNF-alpha (TNF/TNFA). Negatively regulates replication in pancreatic beta-cells, resulting in apoptosis, loss of beta- cells. Phosphorylates MUC1 in breast cancer cells, decreasing the interaction of MUC1 with CTNNB1/beta-catenin. Is necessary for the establishment of neuronal polarity and axon outgrowth. Phosphorylates MARK2, leading to inhibit its activity. Phosphorylates SIK1 at 'Thr-182', leading to sustain its activity.
Subcellular location Cytoplasm (By similarity). Nucleus (By similarity). Membrane. Cell membrane (By similarity). Note=The phosphorylated form shows localization to cytoplasm and cell membrane. The MEMO1-RHOA-DIAPH1 signaling pathway controls localization of the phosophorylated form to the cell membrane (By similarity).

Gene Ontology

GO:0035255 ionotropic glutamate receptor binding MF
GO:0006917 induction of apoptosis BP
GO:0010226 response to lithium ion BP
GO:0050774 negative regulation of dendrite morphogenesis BP
GO:0030010 establishment of cell polarity BP
GO:0005829 cytosol CC
GO:0005625 soluble fraction CC
GO:0005524 ATP binding MF
GO:0043197 dendritic spine CC
GO:0043407 negative regulation of MAP kinase activity BP
GO:0001837 epithelial to mesenchymal transition BP
GO:0009968 negative regulation of signal transduction BP
GO:0045121 membrane raft CC
GO:0030877 beta-catenin destruction complex CC
GO:0005178 integrin binding MF
GO:0045892 negative regulation of transcription, DNA-dependent BP
GO:0048168 regulation of neuronal synaptic plasticity BP
GO:0050321 tau-protein kinase activity MF
GO:0042493 response to drug BP
GO:0019901 protein kinase binding MF
GO:0032886 regulation of microtubule-based process BP
GO:0005886 plasma membrane CC
GO:0051534 negative regulation of NFAT protein import into nucleus BP
GO:0048156 tau protein binding MF
GO:0004674 protein serine/threonine kinase activity MF
GO:0034747 Axin-APC-beta-catenin-GSK3B complex CC
GO:0005977 glycogen metabolic process BP

Sequence

>gi|14091770|ref|NP_114469.1| glycogen synthase kinase-3 beta [Rattus norvegicus]
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVV
YQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVY
RVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRG
EPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ
IREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKL
PNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000003867
UniGene Rn.10426
PDB
RefSeq NP_114469.1
Pfam PF00069