ear 2

General Information (Source: NCBI Gene,UniProt)

Text mining Term	ear 2
UniProt ID	NR2F6_RAT
Name	COUPg Nuclear receptor subfamily 2 group F member 6 V-erbA-related protein 2 Ovalbumin upstream promoter gamma nuclear receptor EAR-2
Gene Names	Nr2f6
Taxonomy	Rattus norvegicus

General annotation

Function	Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type- specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4(+) T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC) (By similarity).
Subcellular location	Nucleus (Probable).

Function

Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type- specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4(+) T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC) (By similarity).

Subcellular location

Nucleus (Probable).

Gene Ontology

GO:0000122	negative regulation of transcription from RNA polymerase II promoter	BP
GO:0043565	sequence-specific DNA binding	MF
GO:0006351	transcription, DNA-dependent	BP
GO:0005634	nucleus	CC
GO:0003707	steroid hormone receptor activity	MF
GO:0008270	zinc ion binding	MF
GO:0003700	sequence-specific DNA binding transcription factor activity	MF

Sequence

>gi|20806167|ref|NP_620813.1| nuclear receptor subfamily 2 group F member 6 [Rattus norvegicus]
MAMVTGGWGGPGGDTNGVDKAGGSYPRATEDDSASPPGATSDAEPGDEERPGLQVDCVVCGDKSSGKHYG
VFTCEGCKSFFKRTIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQPGPIPHALPGPA
ACSPPGAAGVEPFAGPPVSELIAQLLRAEPYPAAGRFGGGGAVLGIDNVCELAARLLFSTVEWARHAPFF
PELPAADQVGLLRLSWSELFVLNAAQAPVPLHTAPLLAAAGLHAGPMAAERAVAFMDQVRAFQEQVDKLG
RLQVDAAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAV
PASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSG

Database Cross Reference

Ensembl Gene
UniGene	Rn.25840
PDB
RefSeq	NP_620813.1
Pfam	PF00105 PF00104

PTID

ear 2

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference