P14

General Information (Source: NCBI Gene,UniProt)

Text mining Term P14
UniProt ID S10A9_RAT
Name p14
Calgranulin-B
Protein S100-A9
MRP-14
Myeloid-related protein 14
Migration inhibitory factor-related protein 14
S100 calcium-binding protein A9
Gene Names S100a9
Synonyms:Mrp14
Taxonomy Rattus norvegicus

General annotation

Function Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS). Promotes tubulin polymerization when unphosphorylated. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as pro- inflammatory mediator in acute and chronic inflammation and up- regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions (By similarity). Stimulates proliferation of fibroblast cells as both a monomer and a homodimer. May act as a mitogen during chronic inflammation.
Subcellular location Secreted (By similarity). Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Peripheral membrane protein (By similarity). Note=Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM- CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes (By similarity).

Gene Ontology

GO:0002544 chronic inflammatory response BP
GO:0005509 calcium ion binding MF
GO:0005886 plasma membrane CC
GO:0005856 cytoskeleton CC
GO:0005737 cytoplasm CC
GO:0045471 response to ethanol BP
GO:0032496 response to lipopolysaccharide BP
GO:0005615 extracellular space CC
GO:0010043 response to zinc ion BP

Sequence

>gi|16758364|ref|NP_446039.1| protein S100-A9 [Rattus norvegicus]
MAAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTN
QDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHRHGKGCGK

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000015351
UniGene Rn.6703
PDB
RefSeq NP_446039.1
Pfam PF01023