| Text mining Term | brain derived neurotrophic factor |
|---|---|
| UniProt ID | BDNF_RAT |
| Name |
BDNF Brain-derived neurotrophic factor |
| Gene Names |
Bdnf
|
| Taxonomy | Rattus norvegicus |
| Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
|---|---|
| Subcellular location |
Secreted. |
| GO:0008083 | growth factor activity | MF |
| GO:0009725 | response to hormone stimulus | BP |
| GO:0045843 | negative regulation of striated muscle tissue development | BP |
| GO:0055093 | response to hyperoxia | BP |
| GO:0014076 | response to fluoxetine | BP |
| GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
| GO:0033189 | response to vitamin A | BP |
| GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
| GO:0005169 | neurotrophin TRKB receptor binding | MF |
| GO:0002544 | chronic inflammatory response | BP |
| GO:0005576 | extracellular region | CC |
| GO:0042493 | response to drug | BP |
| GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
| GO:0072347 | response to anesthetic | BP |
| GO:0050890 | cognition | BP |
| GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
| GO:0001666 | response to hypoxia | BP |
| GO:0008021 | synaptic vesicle | CC |
| GO:0030182 | neuron differentiation | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
| Ensembl Gene | |
|---|---|
| UniGene |
Rn.11266 |
| PDB | |
| RefSeq |
NP_036645.1 |
| Pfam |
PF00243 |