Text mining Term | brain derived neurotrophic factor |
---|---|
UniProt ID | BDNF_RAT |
Name |
BDNF Brain-derived neurotrophic factor |
Gene Names |
Bdnf
|
Taxonomy | Rattus norvegicus |
Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
---|---|
Subcellular location |
Secreted. |
GO:0001666 | response to hypoxia | BP |
GO:0008021 | synaptic vesicle | CC |
GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
GO:0072347 | response to anesthetic | BP |
GO:0055093 | response to hyperoxia | BP |
GO:0050890 | cognition | BP |
GO:0014076 | response to fluoxetine | BP |
GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
GO:0042493 | response to drug | BP |
GO:0033189 | response to vitamin A | BP |
GO:0045843 | negative regulation of striated muscle tissue development | BP |
GO:0009725 | response to hormone stimulus | BP |
GO:0005576 | extracellular region | CC |
GO:0005169 | neurotrophin TRKB receptor binding | MF |
GO:0030182 | neuron differentiation | BP |
GO:0002544 | chronic inflammatory response | BP |
GO:0008083 | growth factor activity | MF |
GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Ensembl Gene | |
---|---|
UniGene |
Rn.11266 |
PDB | |
RefSeq |
NP_036645.1 |
Pfam |
PF00243 |