| Text mining Term | brain derived neurotrophic factor |
|---|---|
| UniProt ID | BDNF_RAT |
| Name |
BDNF Brain-derived neurotrophic factor |
| Gene Names |
Bdnf
|
| Taxonomy | Rattus norvegicus |
| Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
|---|---|
| Subcellular location |
Secreted. |
| GO:0014076 | response to fluoxetine | BP |
| GO:0002544 | chronic inflammatory response | BP |
| GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
| GO:0045843 | negative regulation of striated muscle tissue development | BP |
| GO:0008021 | synaptic vesicle | CC |
| GO:0005576 | extracellular region | CC |
| GO:0055093 | response to hyperoxia | BP |
| GO:0005169 | neurotrophin TRKB receptor binding | MF |
| GO:0001666 | response to hypoxia | BP |
| GO:0008083 | growth factor activity | MF |
| GO:0050890 | cognition | BP |
| GO:0033189 | response to vitamin A | BP |
| GO:0030182 | neuron differentiation | BP |
| GO:0042493 | response to drug | BP |
| GO:0009725 | response to hormone stimulus | BP |
| GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
| GO:0072347 | response to anesthetic | BP |
| GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
| GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
| Ensembl Gene | |
|---|---|
| UniGene |
Rn.11266 |
| PDB | |
| RefSeq |
NP_036645.1 |
| Pfam |
PF00243 |