| Text mining Term | brain derived neurotrophic factor |
|---|---|
| UniProt ID | BDNF_RAT |
| Name |
Brain-derived neurotrophic factor BDNF |
| Gene Names |
Bdnf
|
| Taxonomy | Rattus norvegicus |
| Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
|---|---|
| Subcellular location |
Secreted. |
| GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
| GO:0072347 | response to anesthetic | BP |
| GO:0033189 | response to vitamin A | BP |
| GO:0005576 | extracellular region | CC |
| GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
| GO:0045843 | negative regulation of striated muscle tissue development | BP |
| GO:0009725 | response to hormone stimulus | BP |
| GO:0008083 | growth factor activity | MF |
| GO:0050890 | cognition | BP |
| GO:0001666 | response to hypoxia | BP |
| GO:0002544 | chronic inflammatory response | BP |
| GO:0014076 | response to fluoxetine | BP |
| GO:0055093 | response to hyperoxia | BP |
| GO:0005169 | neurotrophin TRKB receptor binding | MF |
| GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
| GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
| GO:0042493 | response to drug | BP |
| GO:0030182 | neuron differentiation | BP |
| GO:0008021 | synaptic vesicle | CC |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
| Ensembl Gene | |
|---|---|
| UniGene |
Rn.11266 |
| PDB | |
| RefSeq |
NP_036645.1 |
| Pfam |
PF00243 |