| Text mining Term | brain derived neurotrophic factor |
|---|---|
| UniProt ID | BDNF_RAT |
| Name |
Brain-derived neurotrophic factor BDNF |
| Gene Names |
Bdnf
|
| Taxonomy | Rattus norvegicus |
| Function |
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity). |
|---|---|
| Subcellular location |
Secreted. |
| GO:0048170 | positive regulation of long-term neuronal synaptic plasticity | BP |
| GO:0042493 | response to drug | BP |
| GO:0008021 | synaptic vesicle | CC |
| GO:0048172 | regulation of short-term neuronal synaptic plasticity | BP |
| GO:0055093 | response to hyperoxia | BP |
| GO:0060079 | regulation of excitatory postsynaptic membrane potential | BP |
| GO:0014076 | response to fluoxetine | BP |
| GO:0050890 | cognition | BP |
| GO:0002544 | chronic inflammatory response | BP |
| GO:0030182 | neuron differentiation | BP |
| GO:0006120 | mitochondrial electron transport, NADH to ubiquinone | BP |
| GO:0033189 | response to vitamin A | BP |
| GO:0001666 | response to hypoxia | BP |
| GO:0005576 | extracellular region | CC |
| GO:0009725 | response to hormone stimulus | BP |
| GO:0005169 | neurotrophin TRKB receptor binding | MF |
| GO:0072347 | response to anesthetic | BP |
| GO:0008083 | growth factor activity | MF |
| GO:0045843 | negative regulation of striated muscle tissue development | BP |
>gi|6978569|ref|NP_036645.1| brain-derived neurotrophic factor precursor [Rattus norvegicus] MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIE ELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGEL SVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
| Ensembl Gene | |
|---|---|
| UniGene |
Rn.11266 |
| PDB | |
| RefSeq |
NP_036645.1 |
| Pfam |
PF00243 |