prostatic acid phosphatase

General Information (Source: NCBI Gene,UniProt)

Text mining Term	prostatic acid phosphatase
UniProt ID	PPAP_MOUSE
Name	Ecto-5'-nucleotidase 5'-nucleotidase Thiamine monophosphatase Prostatic acid phosphatase Fluoride-resistant acid phosphatase 5'-NT TMPase FRAP
Gene Names	Acpp
Taxonomy	Mus musculus

General annotation

Function	A non-specific tyrosine phosphatase that dephosphorylates a diverse number of substrates under acidic conditions (pH 4-6) including alkyl, aryl, and acyl orthophosphate monoesters and phosphorylated proteins. Has lipid phosphatase activity and inactivates lysophosphatidic acid in seminal plasma (By similarity). Isoform 2: the cellular form also has ecto-5'- nucleotidase activity in dorsal root ganglion (DRG) neurons. Generates adenosine from AMP which acts as a pain suppressor.
Subcellular location	Isoform 1: Secreted (By similarity). Isoform 2: Cell membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Note=Appears to shuttle between the cell membrane and intracellular vesicles. Colocalizes with FLOT1 at cell membrane and in intracellular vesicles. Colocalizes with LAMP2 on the lysosome membrane (By similarity).

Function

A non-specific tyrosine phosphatase that dephosphorylates a diverse number of substrates under acidic conditions (pH 4-6) including alkyl, aryl, and acyl orthophosphate monoesters and phosphorylated proteins. Has lipid phosphatase activity and inactivates lysophosphatidic acid in seminal plasma (By similarity). Isoform 2: the cellular form also has ecto-5'- nucleotidase activity in dorsal root ganglion (DRG) neurons. Generates adenosine from AMP which acts as a pain suppressor.

Subcellular location

Isoform 1: Secreted (By similarity). Isoform 2: Cell membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Note=Appears to shuttle between the cell membrane and intracellular vesicles. Colocalizes with FLOT1 at cell membrane and in intracellular vesicles. Colocalizes with LAMP2 on the lysosome membrane (By similarity).

Gene Ontology

GO:0030175	filopodium	CC
GO:0046085	adenosine metabolic process	BP
GO:0005886	plasma membrane	CC
GO:0016021	integral to membrane	CC
GO:0009117	nucleotide metabolic process	BP
GO:0003993	acid phosphatase activity	MF
GO:0005765	lysosomal membrane	CC
GO:0006144	purine base metabolic process	BP
GO:0008253	5'-nucleotidase activity	MF
GO:0005576	extracellular region	CC

Sequence

>gi|46575782|ref|NP_997551.1| prostatic acid phosphatase isoform 1 precursor [Mus musculus]
MRAVPLPLSRTASLSLGFLLLLSLCLDPGQAKELKFVTLVFRHGDRGPIETFPTDPITESSWPQGFGQLT
QWGMEQHYELGSYIRKRYGRFLNDTYKHDQIYIRSTDVDRTLMSAMTNLAALFPPEGISIWNPRLLWQPI
PVHTVSLSEDRLLYLPFRDCPRFEELKSETLESEEFLKRLHPYKSFLDTLSSLSGFDDQDLFGIWSKVYD
PLFCESVHNFTLPSWATEDAMIKLKELSELSLLSLYGIHKQKEKSRLQGGVLVNEILKNMKLATQPQKYK
KLVMYSAHDTTVSGLQMALDVYNGVLPPYASCHMMELYHDKGGHFVEMYYRNETQNEPYPLTLPGCTHSC
PLEKFAELLDPVISQDWATECMATSSHQVLRVILATTFCLVTGILVILLLVLIRHGPCWQRDVYRNI

Database Cross Reference

Ensembl Gene	ENSMUST00000062723 ENSMUST00000112590
UniGene	Mm.19941
PDB
RefSeq	NP_997551.1 NP_062781.2
Pfam	PF00328

PTID

prostatic acid phosphatase

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference