Text mining Term | delta aminolevulinic acid dehydratase |
---|---|
UniProt ID | HEM2_RAT |
Name |
Delta-aminolevulinic acid dehydratase Porphobilinogen synthase ALADH |
Gene Names |
Alad
|
Taxonomy | Rattus norvegicus |
Function |
Catalyzes an early step in the biosynthesis of tetrapyrroles. Binds two molecules of 5-aminolevulinate per subunit, each at a distinct site, and catalyzes their condensation to form porphobilinogen (By similarity). |
---|---|
Subcellular location |
GO:0014823 | response to activity | BP |
GO:0051597 | response to methylmercury | BP |
GO:0010269 | response to selenium ion | BP |
GO:0046689 | response to mercury ion | BP |
GO:0009635 | response to herbicide | BP |
GO:0070542 | response to fatty acid | BP |
GO:0043200 | response to amino acid stimulus | BP |
GO:0046685 | response to arsenic-containing substance | BP |
GO:0071284 | cellular response to lead ion | BP |
GO:0032791 | lead ion binding | MF |
GO:0033197 | response to vitamin E | BP |
GO:0042493 | response to drug | BP |
GO:0008270 | zinc ion binding | MF |
GO:0046686 | response to cadmium ion | BP |
GO:0005615 | extracellular space | CC |
GO:0010212 | response to ionizing radiation | BP |
GO:0010039 | response to iron ion | BP |
GO:0032025 | response to cobalt ion | BP |
GO:0010044 | response to aluminum ion | BP |
GO:0001666 | response to hypoxia | BP |
GO:0005829 | cytosol | CC |
GO:0070541 | response to platinum ion | BP |
GO:0010266 | response to vitamin B1 | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0010043 | response to zinc ion | BP |
GO:0006979 | response to oxidative stress | BP |
GO:0006783 | heme biosynthetic process | BP |
GO:0004655 | porphobilinogen synthase activity | MF |
GO:0045471 | response to ethanol | BP |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0014070 | response to organic cyclic compound | BP |
>gi|6978483|ref|NP_037031.1| delta-aminolevulinic acid dehydratase [Rattus norvegicus] MHHQSVLHSGYFHPLLRAWQTTPSTVSATNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEMLRPLVE AGLRCVLIFGVPSRVPKDEQGSAADSEDSPTIEAVRLLRKTFPTLLVACDVCLCPYTSHGHCGLLSENGA FLAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKAALLKHGLGNRVSVMSYSAKFASCFYGPFRD AAQSSPAFGDRRCYQLPPGARGLALRAVARDIQEGADILMVKPGLPYLDMVQEVKDKHPELPLAVYQVSG EFAMLWHGAKAGAFDLRTAVLESMTAFRRAGADIIITYFAPQLLKWLKEE |
Ensembl Gene |
ENSRNOT00000020625 |
---|---|
UniGene |
Rn.3941 |
PDB | |
RefSeq |
NP_037031.1 |
Pfam |
PF00490 |