leptin

General Information (Source: NCBI Gene,UniProt)

Text mining Term leptin
UniProt ID LEP_RAT
Name Obesity factor
Leptin
Gene Names Lep
Synonyms:Ob
Taxonomy Rattus norvegicus

General annotation

Function May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of Lep may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Subcellular location Secreted (Probable).

Gene Ontology

GO:0035630 bone mineralization involved in bone maturation BP
GO:2000486 negative regulation of glutamine transport BP
GO:0060587 regulation of lipoprotein lipid oxidation BP
GO:0046628 positive regulation of insulin receptor signaling pathway BP
GO:0033686 positive regulation of luteinizing hormone secretion BP
GO:0046881 positive regulation of follicle-stimulating hormone secretion BP
GO:0050901 leukocyte tethering or rolling BP
GO:0006112 energy reserve metabolic process BP
GO:0007565 female pregnancy BP
GO:0005615 extracellular space CC
GO:0008284 positive regulation of cell proliferation BP
GO:0042517 positive regulation of tyrosine phosphorylation of Stat3 protein BP
GO:0007623 circadian rhythm BP
GO:0043410 positive regulation of MAPKKK cascade BP
GO:0033210 leptin-mediated signaling pathway BP
GO:0001819 positive regulation of cytokine production BP
GO:0019933 cAMP-mediated signaling BP
GO:0002021 response to dietary excess BP
GO:0033197 response to vitamin E BP
GO:0005622 intracellular CC
GO:0001666 response to hypoxia BP
GO:0008343 adult feeding behavior BP
GO:0045906 negative regulation of vasoconstriction BP
GO:0032099 negative regulation of appetite BP
GO:0007259 JAK-STAT cascade BP
GO:0071298 cellular response to L-ascorbic acid BP
GO:2000491 positive regulation of hepatic stellate cell activation BP
GO:0005179 hormone activity MF
GO:0043066 negative regulation of apoptotic process BP
GO:0008217 regulation of blood pressure BP
GO:0061037 negative regulation of cartilage development BP
GO:0043270 positive regulation of ion transport BP
GO:0001542 ovulation from ovarian follicle BP
GO:0071300 cellular response to retinoic acid BP
GO:0009062 fatty acid catabolic process BP
GO:0006114 glycerol biosynthetic process BP
GO:0005125 cytokine activity MF
GO:0051428 peptide hormone receptor binding MF

Sequence

>gi|6981148|ref|NP_037208.1| leptin precursor [Rattus norvegicus]
MCWRPLCRFLWLWSYLSYVQAVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPIL
SLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLY
STEVVALSRLQGSLQDILQQLDLSPEC

Options for BLAST

Database:

Set subsequence:(optional):
From: To:

Optional parameters:
Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000008020
UniGene Rn.44444
PDB
RefSeq NP_037208.1
Pfam PF02024