survivin

General Information (Source: NCBI Gene,UniProt)

Text mining Term	survivin
UniProt ID	BIRC5_MOUSE
Name	TIAP Apoptosis inhibitor survivin Baculoviral IAP repeat-containing protein 5 Apoptosis inhibitor 4
Gene Names	Birc5
Taxonomy	Mus musculus

General annotation

Function	Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May play a role in neoplasia. May counteract a default induction of apoptosis in G2/M phase. Inhibitor of caspase-3 and caspase-7 (By similarity).
Subcellular location	Cytoplasm (By similarity). Nucleus (By similarity). Chromosome, centromere (By similarity). Cytoplasm, cytoskeleton, spindle (By similarity). Note=Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Colocalizes with AURKB at mitotic chromosomes (By similarity).

Function

Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May play a role in neoplasia. May counteract a default induction of apoptosis in G2/M phase. Inhibitor of caspase-3 and caspase-7 (By similarity).

Subcellular location

Cytoplasm (By similarity). Nucleus (By similarity). Chromosome, centromere (By similarity). Cytoplasm, cytoskeleton, spindle (By similarity). Note=Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Colocalizes with AURKB at mitotic chromosomes (By similarity).

Gene Ontology

GO:0005634	nucleus	CC
GO:0008017	microtubule binding	MF
GO:0000775	chromosome, centromeric region	CC
GO:0031503	protein complex localization	BP
GO:0005814	centriole	CC
GO:0043524	negative regulation of neuron apoptosis	BP
GO:0031577	spindle checkpoint	BP
GO:0008270	zinc ion binding	MF
GO:0000086	G2/M transition of mitotic cell cycle	BP
GO:0005876	spindle microtubule	CC
GO:0005881	cytoplasmic microtubule	CC
GO:0009790	embryo development	BP
GO:0051303	establishment of chromosome localization	BP
GO:0030496	midbody	CC
GO:0006916	anti-apoptosis	BP
GO:0031536	positive regulation of exit from mitosis	BP
GO:0007059	chromosome segregation	BP
GO:0000226	microtubule cytoskeleton organization	BP
GO:0031021	interphase microtubule organizing center	CC
GO:0000910	cytokinesis	BP
GO:0032133	chromosome passenger complex	CC
GO:0007067	mitosis	BP
GO:0045931	positive regulation of mitotic cell cycle	BP
GO:0048037	cofactor binding	MF
GO:0042803	protein homodimerization activity	MF
GO:0005829	cytosol	CC
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	MF

Sequence

>gi|59859890|ref|NP_001012273.1| baculoviral IAP repeat-containing protein 5 isoform 3 [Mus musculus]
MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPD
DNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIVCMIENKD

Database Cross Reference

Ensembl Gene	ENSMUST00000081387 ENSMUST00000106322 ENSMUST00000093906
UniGene	Mm.8552
PDB	1M4M
RefSeq	NP_033819.1 NP_001012273.1
Pfam	PF00653

PTID

survivin

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference