Text mining Term | survivin |
---|---|
UniProt ID | BIRC5_MOUSE |
Name |
TIAP Apoptosis inhibitor survivin Apoptosis inhibitor 4 Baculoviral IAP repeat-containing protein 5 |
Gene Names |
Birc5
|
Taxonomy | Mus musculus |
Function |
Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May play a role in neoplasia. May counteract a default induction of apoptosis in G2/M phase. Inhibitor of caspase-3 and caspase-7 (By similarity). |
---|---|
Subcellular location |
Cytoplasm (By similarity). Nucleus (By similarity). Chromosome, centromere (By similarity). Cytoplasm, cytoskeleton, spindle (By similarity). Note=Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Colocalizes with AURKB at mitotic chromosomes (By similarity). |
GO:0005881 | cytoplasmic microtubule | CC |
GO:0005814 | centriole | CC |
GO:0030496 | midbody | CC |
GO:0048037 | cofactor binding | MF |
GO:0032133 | chromosome passenger complex | CC |
GO:0005829 | cytosol | CC |
GO:0031021 | interphase microtubule organizing center | CC |
GO:0009790 | embryo development | BP |
GO:0000910 | cytokinesis | BP |
GO:0031503 | protein complex localization | BP |
GO:0000226 | microtubule cytoskeleton organization | BP |
GO:0000086 | G2/M transition of mitotic cell cycle | BP |
GO:0005876 | spindle microtubule | CC |
GO:0031577 | spindle checkpoint | BP |
GO:0007059 | chromosome segregation | BP |
GO:0043027 | cysteine-type endopeptidase inhibitor activity involved in apoptotic process | MF |
GO:0000775 | chromosome, centromeric region | CC |
GO:0008270 | zinc ion binding | MF |
GO:0051303 | establishment of chromosome localization | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0031536 | positive regulation of exit from mitosis | BP |
GO:0008017 | microtubule binding | MF |
GO:0005634 | nucleus | CC |
GO:0042803 | protein homodimerization activity | MF |
GO:0007067 | mitosis | BP |
GO:0006916 | anti-apoptosis | BP |
GO:0045931 | positive regulation of mitotic cell cycle | BP |
>gi|59859890|ref|NP_001012273.1| baculoviral IAP repeat-containing protein 5 isoform 3 [Mus musculus] MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPD DNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIVCMIENKD |
Ensembl Gene |
ENSMUST00000106322 ENSMUST00000081387 ENSMUST00000093906 |
---|---|
UniGene |
Mm.8552 |
PDB |
1M4M |
RefSeq |
NP_033819.1 NP_001012273.1 |
Pfam |
PF00653 |