| Text mining Term | osteonectin |
|---|---|
| UniProt ID | SPRC_RAT |
| Name |
Osteonectin BM-40 SPARC Secreted protein acidic and rich in cysteine ON Basement-membrane protein 40 |
| Gene Names |
Sparc
|
| Taxonomy | Rattus norvegicus |
| Function |
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
|---|---|
| Subcellular location |
Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane (By similarity). |
| GO:0051384 | response to glucocorticoid stimulus | BP |
| GO:0005634 | nucleus | CC |
| GO:0032496 | response to lipopolysaccharide | BP |
| GO:0005737 | cytoplasm | CC |
| GO:0010288 | response to lead ion | BP |
| GO:0042060 | wound healing | BP |
| GO:0007507 | heart development | BP |
| GO:0001503 | ossification | BP |
| GO:0033591 | response to L-ascorbic acid | BP |
| GO:0009629 | response to gravity | BP |
| GO:0031988 | membrane-bounded vesicle | CC |
| GO:0005509 | calcium ion binding | MF |
| GO:0005604 | basement membrane | CC |
| GO:0034097 | response to cytokine stimulus | BP |
| GO:0045471 | response to ethanol | BP |
| GO:0005615 | extracellular space | CC |
| GO:0048839 | inner ear development | BP |
| GO:0046686 | response to cadmium ion | BP |
| GO:0030324 | lung development | BP |
| GO:0007165 | signal transduction | BP |
| GO:0043434 | response to peptide hormone stimulus | BP |
| GO:0051591 | response to cAMP | BP |
| GO:0051592 | response to calcium ion | BP |
>gi|6981574|ref|NP_036788.1| SPARC precursor [Rattus norvegicus] MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPC QNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLH LDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHP VELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIA LEEWAGCFGIKEQDINKDLVI |
| Ensembl Gene |
ENSRNOT00000017486 |
|---|---|
| UniGene |
Rn.98989 |
| PDB | |
| RefSeq |
NP_036788.1 |
| Pfam |
PF09289 PF00050 PF10591 |