Text mining Term | osteonectin |
---|---|
UniProt ID | SPRC_RAT |
Name |
Osteonectin SPARC ON BM-40 Secreted protein acidic and rich in cysteine Basement-membrane protein 40 |
Gene Names |
Sparc
|
Taxonomy | Rattus norvegicus |
Function |
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
---|---|
Subcellular location |
Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane (By similarity). |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0051591 | response to cAMP | BP |
GO:0042060 | wound healing | BP |
GO:0001503 | ossification | BP |
GO:0005604 | basement membrane | CC |
GO:0005615 | extracellular space | CC |
GO:0034097 | response to cytokine stimulus | BP |
GO:0046686 | response to cadmium ion | BP |
GO:0033591 | response to L-ascorbic acid | BP |
GO:0031988 | membrane-bounded vesicle | CC |
GO:0051592 | response to calcium ion | BP |
GO:0045471 | response to ethanol | BP |
GO:0007165 | signal transduction | BP |
GO:0010288 | response to lead ion | BP |
GO:0005634 | nucleus | CC |
GO:0043434 | response to peptide hormone stimulus | BP |
GO:0007507 | heart development | BP |
GO:0009629 | response to gravity | BP |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0048839 | inner ear development | BP |
GO:0030324 | lung development | BP |
GO:0005737 | cytoplasm | CC |
GO:0005509 | calcium ion binding | MF |
>gi|6981574|ref|NP_036788.1| SPARC precursor [Rattus norvegicus] MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPC QNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLH LDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHP VELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIA LEEWAGCFGIKEQDINKDLVI |
Ensembl Gene |
ENSRNOT00000017486 |
---|---|
UniGene |
Rn.98989 |
PDB | |
RefSeq |
NP_036788.1 |
Pfam |
PF09289 PF10591 PF00050 |