Text mining Term | osteonectin |
---|---|
UniProt ID | SPRC_RAT |
Name |
Secreted protein acidic and rich in cysteine SPARC Basement-membrane protein 40 BM-40 Osteonectin ON |
Gene Names |
Sparc
|
Taxonomy | Rattus norvegicus |
Function |
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
---|---|
Subcellular location |
Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane (By similarity). |
GO:0010288 | response to lead ion | BP |
GO:0031988 | membrane-bounded vesicle | CC |
GO:0005634 | nucleus | CC |
GO:0005737 | cytoplasm | CC |
GO:0034097 | response to cytokine stimulus | BP |
GO:0007507 | heart development | BP |
GO:0043434 | response to peptide hormone stimulus | BP |
GO:0009629 | response to gravity | BP |
GO:0046686 | response to cadmium ion | BP |
GO:0005509 | calcium ion binding | MF |
GO:0051592 | response to calcium ion | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0051591 | response to cAMP | BP |
GO:0033591 | response to L-ascorbic acid | BP |
GO:0007165 | signal transduction | BP |
GO:0048839 | inner ear development | BP |
GO:0030324 | lung development | BP |
GO:0042060 | wound healing | BP |
GO:0005604 | basement membrane | CC |
GO:0005615 | extracellular space | CC |
GO:0001503 | ossification | BP |
GO:0045471 | response to ethanol | BP |
>gi|6981574|ref|NP_036788.1| SPARC precursor [Rattus norvegicus] MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPC QNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLH LDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHP VELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIA LEEWAGCFGIKEQDINKDLVI |
Ensembl Gene |
ENSRNOT00000017486 |
---|---|
UniGene |
Rn.98989 |
PDB | |
RefSeq |
NP_036788.1 |
Pfam |
PF10591 PF09289 PF00050 |