Text mining Term | osteonectin |
---|---|
UniProt ID | SPRC_RAT |
Name |
Basement-membrane protein 40 Osteonectin Secreted protein acidic and rich in cysteine BM-40 ON SPARC |
Gene Names |
Sparc
|
Taxonomy | Rattus norvegicus |
Function |
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. |
---|---|
Subcellular location |
Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane (By similarity). |
GO:0031988 | membrane-bounded vesicle | CC |
GO:0007165 | signal transduction | BP |
GO:0046686 | response to cadmium ion | BP |
GO:0005737 | cytoplasm | CC |
GO:0051591 | response to cAMP | BP |
GO:0042060 | wound healing | BP |
GO:0007507 | heart development | BP |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0034097 | response to cytokine stimulus | BP |
GO:0005604 | basement membrane | CC |
GO:0030324 | lung development | BP |
GO:0043434 | response to peptide hormone stimulus | BP |
GO:0048839 | inner ear development | BP |
GO:0045471 | response to ethanol | BP |
GO:0010288 | response to lead ion | BP |
GO:0005509 | calcium ion binding | MF |
GO:0005634 | nucleus | CC |
GO:0033591 | response to L-ascorbic acid | BP |
GO:0001503 | ossification | BP |
GO:0051592 | response to calcium ion | BP |
GO:0005615 | extracellular space | CC |
GO:0009629 | response to gravity | BP |
>gi|6981574|ref|NP_036788.1| SPARC precursor [Rattus norvegicus] MRAWIFFLLCLAGRALAAPQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPC QNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLH LDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHP VELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIA LEEWAGCFGIKEQDINKDLVI |
Ensembl Gene |
ENSRNOT00000017486 |
---|---|
UniGene |
Rn.98989 |
PDB | |
RefSeq |
NP_036788.1 |
Pfam |
PF09289 PF10591 PF00050 |