Text mining Term | monocyte chemoattractant protein 1 |
---|---|
UniProt ID | CCL2_RAT |
Name |
Monocyte chemotactic protein 1 Monocyte chemoattractant protein 1 Small-inducible cytokine A2 C-C motif chemokine 2 Immediate-early serum-responsive protein JE MCP-1 |
Gene Names |
Ccl2
|
Taxonomy | Rattus norvegicus |
Function |
Chemotactic factor that attracts monocytes, but not neutrophils. |
---|---|
Subcellular location |
Secreted. |
GO:0001938 | positive regulation of endothelial cell proliferation | BP |
GO:0008009 | chemokine activity | MF |
GO:0005737 | cytoplasm | CC |
GO:0007568 | aging | BP |
GO:0007179 | transforming growth factor beta receptor signaling pathway | BP |
GO:0009612 | response to mechanical stimulus | BP |
GO:0006954 | inflammatory response | BP |
GO:0048246 | macrophage chemotaxis | BP |
GO:0010332 | response to gamma radiation | BP |
GO:0031100 | organ regeneration | BP |
GO:0043025 | neuronal cell body | CC |
GO:0048247 | lymphocyte chemotaxis | BP |
GO:0032570 | response to progesterone stimulus | BP |
GO:0051384 | response to glucocorticoid stimulus | BP |
GO:0043200 | response to amino acid stimulus | BP |
GO:0030593 | neutrophil chemotaxis | BP |
GO:0045471 | response to ethanol | BP |
GO:0031727 | CCR2 chemokine receptor binding | MF |
GO:0070098 | chemokine-mediated signaling pathway | BP |
GO:0006874 | cellular calcium ion homeostasis | BP |
GO:0048010 | vascular endothelial growth factor receptor signaling pathway | BP |
GO:0046677 | response to antibiotic | BP |
GO:0042466 | chemokinesis | BP |
GO:0014823 | response to activity | BP |
GO:0060137 | maternal process involved in parturition | BP |
GO:0009408 | response to heat | BP |
GO:0042493 | response to drug | BP |
GO:0001666 | response to hypoxia | BP |
GO:0033552 | response to vitamin B3 | BP |
GO:0050806 | positive regulation of synaptic transmission | BP |
GO:0005615 | extracellular space | CC |
GO:0008201 | heparin binding | MF |
>gi|13928714|ref|NP_113718.1| C-C motif chemokine 2 [Rattus norvegicus] MQVSVTLLGLLFTVAACSIHVLSQPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKL KREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSV EVTSMTEN |
Ensembl Gene |
ENSRNOT00000009448 |
---|---|
UniGene |
Rn.4772 |
PDB | |
RefSeq |
NP_113718.1 |
Pfam |
PF00048 |