Text mining Term | glucocorticoid receptor |
---|---|
UniProt ID | GCR_RAT |
Name |
Nuclear receptor subfamily 3 group C member 1 GR Glucocorticoid receptor |
Gene Names |
Nr3c1
Synonyms:Grl |
Taxonomy | Rattus norvegicus |
Function |
Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth. Involved in chromatin remodeling. Plays a significant role in transactivation. Involved in nuclear translocation (By similarity). |
---|---|
Subcellular location |
Cytoplasm (By similarity). Nucleus (By similarity). Note=Cytoplasmic in the absence of ligand, nuclear after ligand-binding (By similarity). |
GO:0030971 | receptor tyrosine kinase binding | MF |
GO:0048096 | chromatin-mediated maintenance of transcription | BP |
GO:0003682 | chromatin binding | MF |
GO:0046982 | protein heterodimerization activity | MF |
GO:0014049 | positive regulation of glutamate secretion | BP |
GO:0004883 | glucocorticoid receptor activity | MF |
GO:0007623 | circadian rhythm | BP |
GO:0046689 | response to mercury ion | BP |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | BP |
GO:0019717 | synaptosome | CC |
GO:0071286 | cellular response to magnesium ion | BP |
GO:0042803 | protein homodimerization activity | MF |
GO:0005496 | steroid binding | MF |
GO:0043116 | negative regulation of vascular permeability | BP |
GO:0003700 | sequence-specific DNA binding transcription factor activity | MF |
GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway | BP |
GO:0007420 | brain development | BP |
GO:0051412 | response to corticosterone stimulus | BP |
GO:0006351 | transcription, DNA-dependent | BP |
GO:0003690 | double-stranded DNA binding | MF |
GO:0043565 | sequence-specific DNA binding | MF |
GO:0043234 | protein complex | CC |
GO:0003713 | transcription coactivator activity | MF |
GO:0014823 | response to activity | BP |
GO:0008270 | zinc ion binding | MF |
GO:0014069 | postsynaptic density | CC |
GO:0051879 | Hsp90 protein binding | MF |
GO:0009314 | response to radiation | BP |
GO:0030544 | Hsp70 protein binding | MF |
GO:0071549 | cellular response to dexamethasone stimulus | BP |
GO:0030324 | lung development | BP |
GO:0007568 | aging | BP |
GO:0042127 | regulation of cell proliferation | BP |
GO:0046685 | response to arsenic-containing substance | BP |
GO:0014889 | muscle atrophy | BP |
GO:0032868 | response to insulin stimulus | BP |
GO:0005634 | nucleus | CC |
GO:0006916 | anti-apoptosis | BP |
>gi|158303300|ref|NP_036708.2| glucocorticoid receptor [Rattus norvegicus] MDSKESLAPPGRDEVPGSLLGQGRGSVMDFYKSLRGGATVKVSASSPSVAAASQADSKQQRILLDFSKGS TSNVQQRQQQQQQQQQQQQQQQQQQPDLSKAVSLSMGLYMGETETKVMGNDLGYPQQGQLGLSSGETDFR LLEESIANLNRSTSVPENPKSSTSATGCATPTEKEFPKTHSDASSEQQNRKSQTGTNGGSVKLYPTDQST FDLLKDLEFSAGSPGKDTNESPWRSDLLIDENLLSPLAGEDDPFLLEGDTNEDCKPLILPDTKPKIKDTG DTILSSPSSVALPQVKTEKDDFIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQM YHYDMNTASLSQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDSLTSLGALNFPGRSVFSNGYSSPGMRPD VSSPPSSSSAATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKN CPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQDTSENPNKTIVPAALPQLTPTLVSLLEVIEPEV LYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSY RQSSGNLLCFAPDLIINEQRMSLPCMYDQCKHMLFVSSELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQ ELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLTYCFQTFLDKTMSIEFPEML AEIITNQIPKYSNGNIKKLLFHQK |
Ensembl Gene | |
---|---|
UniGene |
Rn.90070 |
PDB |
3G9P 1LAT 3G97 1GDC 1RGD 3G6T 3G9O 3G9J 3FYL 1R4O 3G6Q 3G9M 3G8U 2GDA 1R4R 3G6R 3G9I 1GLU 3G6U 3G6P 3G99 3G8X |
RefSeq |
NP_036708.2 |
Pfam |
PF00105 PF00104 PF02155 |