| Text mining Term | P25 |
|---|---|
| UniProt ID | NGAL_RAT |
| Name |
Neutrophil gelatinase-associated lipocalin Alpha-2-microglobulin-related protein p25 Lipocalin-2 NGAL Alpha-2U globulin-related protein |
| Gene Names |
Lcn2
|
| Taxonomy | Rattus norvegicus |
| Function |
Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. Binds iron through association with 2,5-dihydroxybenzoic acid (2,5- DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth (By similarity). |
|---|---|
| Subcellular location |
Secreted (By similarity). Note=Upon binding to the SLC22A17 (24p3R) receptor, it is internalized (By similarity). |
| GO:0005506 | iron ion binding | MF |
| GO:0070207 | protein homotrimerization | BP |
| GO:0010628 | positive regulation of gene expression | BP |
| GO:0071347 | cellular response to interleukin-1 | BP |
| GO:0005215 | transporter activity | MF |
| GO:0070301 | cellular response to hydrogen peroxide | BP |
| GO:0031669 | cellular response to nutrient levels | BP |
| GO:0005615 | extracellular space | CC |
| GO:0071222 | cellular response to lipopolysaccharide | BP |
| GO:0005829 | cytosol | CC |
| GO:0042803 | protein homodimerization activity | MF |
| GO:0002020 | protease binding | MF |
| GO:0009635 | response to herbicide | BP |
| GO:0006915 | apoptotic process | BP |
| GO:0031346 | positive regulation of cell projection organization | BP |
| GO:0015891 | siderophore transport | BP |
| GO:0045087 | innate immune response | BP |
| GO:0042493 | response to drug | BP |
| GO:0042981 | regulation of apoptotic process | BP |
| GO:0071356 | cellular response to tumor necrosis factor | BP |
>gi|18543345|ref|NP_570097.1| neutrophil gelatinase-associated lipocalin precursor [Rattus norvegicus] MGLGVLCLALVLLGVLQRQAQDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAANAVQKERQSRFT MYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAM VFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN |
| Ensembl Gene |
ENSRNOT00000018776 |
|---|---|
| UniGene |
Rn.11303 |
| PDB |
2K23 |
| RefSeq |
NP_570097.1 |
| Pfam |
PF00061 |