thioredoxin

General Information (Source: NCBI Gene,UniProt)

Text mining Term	thioredoxin
UniProt ID	THIO_RAT
Name	Trx Thioredoxin
Gene Names	Txn Synonyms:Txn1
Taxonomy	Rattus norvegicus

General annotation

Function	Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions (By similarity). Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity (By similarity).
Subcellular location	Nucleus (By similarity). Cytoplasm (By similarity). Secreted (By similarity). Note=Secreted by a leaderless secretory pathway. Predominantly in the cytoplasm in non irradiated cells. Radiation induces translocation of TRX from the cytoplasm to the nucleus (By similarity).

Function

Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions (By similarity). Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity (By similarity).

Subcellular location

Nucleus (By similarity). Cytoplasm (By similarity). Secreted (By similarity). Note=Secreted by a leaderless secretory pathway. Predominantly in the cytoplasm in non irradiated cells. Radiation induces translocation of TRX from the cytoplasm to the nucleus (By similarity).

Gene Ontology

GO:0005576	extracellular region	CC
GO:0030424	axon	CC
GO:0006662	glycerol ether metabolic process	BP
GO:0071333	cellular response to glucose stimulus	BP
GO:0006355	regulation of transcription, DNA-dependent	BP
GO:0071548	response to dexamethasone stimulus	BP
GO:0005634	nucleus	CC
GO:0005829	cytosol	CC
GO:0006351	transcription, DNA-dependent	BP
GO:0009314	response to radiation	BP
GO:0004791	thioredoxin-disulfide reductase activity	MF
GO:0048678	response to axon injury	BP
GO:0006810	transport	BP
GO:0071455	cellular response to hyperoxia	BP
GO:0022900	electron transport chain	BP
GO:0043025	neuronal cell body	CC
GO:0014823	response to activity	BP
GO:0030425	dendrite	CC
GO:0043388	positive regulation of DNA binding	BP
GO:0009055	electron carrier activity	MF
GO:0010269	response to selenium ion	BP
GO:0033158	regulation of protein import into nucleus, translocation	BP
GO:0015035	protein disulfide oxidoreductase activity	MF
GO:0016999	antibiotic metabolic process	BP
GO:0097068	response to thyroxine stimulus	BP
GO:0035690	cellular response to drug	BP
GO:0019899	enzyme binding	MF

Sequence

>gi|16758644|ref|NP_446252.1| thioredoxin [Rattus norvegicus]
MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVDDCQDVAADCE
VKCMPTFQFYKKGQKVGEFSGANKEKLEATITEFA

Database Cross Reference

Ensembl Gene	ENSRNOT00000016447
UniGene	Rn.29777
PDB
RefSeq	NP_446252.1
Pfam	PF00085

PTID

thioredoxin

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference