Text mining Term | thioredoxin reductase |
---|---|
UniProt ID | PRDX2_MOUSE |
Name |
TSA Thiol-specific antioxidant protein Thioredoxin-dependent peroxide reductase 1 Thioredoxin peroxidase 1 Peroxiredoxin-2 |
Gene Names |
Prdx2
|
Taxonomy | Mus musculus |
Function |
Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). |
---|---|
Subcellular location |
Cytoplasm. |
GO:0030194 | positive regulation of blood coagulation | BP |
GO:0002536 | respiratory burst involved in inflammatory response | BP |
GO:0005739 | mitochondrion | CC |
GO:0010310 | regulation of hydrogen peroxide metabolic process | BP |
GO:0008430 | selenium binding | MF |
GO:0008379 | thioredoxin peroxidase activity | MF |
GO:0042744 | hydrogen peroxide catabolic process | BP |
GO:0019430 | removal of superoxide radicals | BP |
GO:0045581 | negative regulation of T cell differentiation | BP |
GO:0006916 | anti-apoptosis | BP |
GO:0032088 | negative regulation of NF-kappaB transcription factor activity | BP |
GO:0031665 | negative regulation of lipopolysaccharide-mediated signaling pathway | BP |
GO:0005515 | protein binding | MF |
GO:2000378 | negative regulation of reactive oxygen species metabolic process | BP |
GO:0042098 | T cell proliferation | BP |
GO:0000187 | activation of MAPK activity | BP |
GO:0048872 | homeostasis of number of cells | BP |
GO:0032496 | response to lipopolysaccharide | BP |
GO:0048538 | thymus development | BP |
>gi|148747558|ref|NP_035693.3| peroxiredoxin-2 [Mus musculus] MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGC EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQ ITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
Ensembl Gene |
ENSMUST00000005292 ENSMUST00000109734 ENSMUST00000109733 ENSMUST00000164807 |
---|---|
UniGene |
Mm.347009 Mm.393373 |
PDB | |
RefSeq |
NP_035693.3 |
Pfam |
PF10417 PF00578 |