Text mining Term | galanin |
---|---|
UniProt ID | GALA_RAT |
Name |
GMAP Galanin peptides Galanin Galanin message-associated peptide |
Gene Names |
Gal
Synonyms:Galn |
Taxonomy | Rattus norvegicus |
Function |
Contracts smooth muscle of the gastrointestinal and genitourinary tract, regulates growth hormone release, modulates insulin release, and may be involved in the control of adrenal secretion. |
---|---|
Subcellular location |
Secreted. |
GO:0043065 | positive regulation of apoptotic process | BP |
GO:0005179 | hormone activity | MF |
GO:0032868 | response to insulin stimulus | BP |
GO:0050672 | negative regulation of lymphocyte proliferation | BP |
GO:0007631 | feeding behavior | BP |
GO:0005576 | extracellular region | CC |
GO:0043627 | response to estrogen stimulus | BP |
GO:0005794 | Golgi apparatus | CC |
GO:0030141 | secretory granule | CC |
GO:0031943 | regulation of glucocorticoid metabolic process | BP |
GO:0001664 | G-protein coupled receptor binding | MF |
GO:0050776 | regulation of immune response | BP |
GO:0006954 | inflammatory response | BP |
GO:0042493 | response to drug | BP |
GO:0007218 | neuropeptide signaling pathway | BP |
>gi|15147221|ref|NP_150240.1| galanin peptides preproprotein [Rattus norvegicus] MARGSVILLAWLLLVATLSATLGLGMPTKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELPLEV EEGRLGSVAVPLPESNIVRTIMEFLSFLHLKEAGALDSLPGIPLATSSEDLEQS |
Ensembl Gene |
ENSRNOT00000020425 |
---|---|
UniGene |
Rn.8929 |
PDB | |
RefSeq |
NP_150240.1 |
Pfam |
PF06540 PF01296 |