| Text mining Term | beta endorphin |
|---|---|
| UniProt ID | COLI_MOUSE |
| Name |
Pro-opiomelanocortin Met-enkephalin POMC Melanotropin gamma Corticotropin-like intermediary peptide CLIP Gamma-MSH Beta-LPH Beta-MSH Melanotropin alpha Lipotropin gamma NPP Gamma-LPH Alpha-MSH Corticotropin-lipotropin Adrenocorticotropic hormone Melanotropin beta Corticotropin Beta-endorphin ACTH Lipotropin beta |
| Gene Names |
Pomc
Synonyms:Pomc1 |
| Taxonomy | Mus musculus |
| Function |
ACTH stimulates the adrenal glands to release cortisol.
MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes.
Beta-endorphin and Met-enkephalin are endogenous opiates. |
|---|---|
| Subcellular location |
Secreted (By similarity). |
| GO:0032720 | negative regulation of tumor necrosis factor production | BP |
| GO:0007218 | neuropeptide signaling pathway | BP |
| GO:0070996 | type 1 melanocortin receptor binding | MF |
| GO:0007267 | cell-cell signaling | BP |
| GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | BP |
| GO:0005179 | hormone activity | MF |
| GO:0030141 | secretory granule | CC |
| GO:0005615 | extracellular space | CC |
| GO:0006091 | generation of precursor metabolites and energy | BP |
| GO:0032098 | regulation of appetite | BP |
| GO:0033059 | cellular pigmentation | BP |
>gi|6679415|ref|NP_032921.1| pro-opiomelanocortin precursor [Mus musculus] MPRFCYSRSGALLLALLLQTSIDVWSWCLESSQCQDLTTESNLLACIRACKLDLSLETPVFPGNGDEQPL TENPRKYVMGHFRWDRFGPRNSSSAGSAAQRRAEEEAVWGDGSPEPSPREGKRSYSMEHFRWGKPVGKKR RPVKVYPNVAENESAEAFPLEFKRELEGERPLGLEQVLESDAEKDDGPYRVEHFRWSNPPKDKRYGGFMT SEKSQTPLVTLFKNAIIKNAHKKGQ |
| Ensembl Gene |
ENSMUST00000020990 |
|---|---|
| UniGene |
Mm.277996 |
| PDB | |
| RefSeq |
NP_032921.1 |
| Pfam |
PF08384 PF00976 PF08035 |