epidermal growth factor

General Information (Source: NCBI Gene,UniProt)

Text mining Term	epidermal growth factor
UniProt ID	EGFR_DROME
Name	Egfr Epidermal growth factor receptor Protein torpedo Gurken receptor Drosophila relative of ERBB
Gene Names	Egfr
Taxonomy	Drosophila melanogaster

General annotation

Function	Binds to four ligands: Spitz, Gurken, Vein and Argos, which is an antagonist. Transduces the signal through the ras-raf- MAPK pathway. Involved in a myriad of developmental decisions. Critical for the proliferation of imaginal tissues, and for the determination of both the antero-posterior and dorso-ventral polarities of the oocyte. In the embryo, plays a role in the establishment of ventral cell fates, maintenance of amnioserosa and ventral neuroectodermal cells, germ band retraction, cell fate specification in the central nervous system and production of cuticle.
Subcellular location	Membrane; Single-pass type I membrane protein.

Function

Binds to four ligands: Spitz, Gurken, Vein and Argos, which is an antagonist. Transduces the signal through the ras-raf- MAPK pathway. Involved in a myriad of developmental decisions. Critical for the proliferation of imaginal tissues, and for the determination of both the antero-posterior and dorso-ventral polarities of the oocyte. In the embryo, plays a role in the establishment of ventral cell fates, maintenance of amnioserosa and ventral neuroectodermal cells, germ band retraction, cell fate specification in the central nervous system and production of cuticle.

Subcellular location

Membrane; Single-pass type I membrane protein.

Gene Ontology

GO:0007367	segment polarity determination	BP
GO:0007455	eye-antennal disc morphogenesis	BP
GO:0006916	anti-apoptosis	BP
GO:0007479	leg disc proximal/distal pattern formation	BP
GO:0007458	progression of morphogenetic furrow involved in compound eye morphogenesis	BP
GO:0007474	imaginal disc-derived wing vein specification	BP
GO:0042694	muscle cell fate specification	BP
GO:0007314	oocyte anterior/posterior axis specification	BP
GO:0007443	Malpighian tubule morphogenesis	BP
GO:0035310	notum cell fate specification	BP
GO:0007477	notum development	BP
GO:0007369	gastrulation	BP
GO:0016203	muscle attachment	BP
GO:0007390	germ-band shortening	BP
GO:0045466	R7 cell differentiation	BP
GO:0048139	female germ-line cyst encapsulation	BP
GO:0005886	plasma membrane	CC
GO:0008406	gonad development	BP
GO:0007473	wing disc proximal/distal pattern formation	BP
GO:0005515	protein binding	MF
GO:0035225	determination of genital disc primordium	BP
GO:0035160	maintenance of epithelial integrity, open tracheal system	BP
GO:0016021	integral to membrane	CC
GO:0001752	compound eye photoreceptor fate commitment	BP
GO:0035088	establishment or maintenance of apical/basal cell polarity	BP
GO:0046843	dorsal appendage formation	BP
GO:0005524	ATP binding	MF
GO:0030031	cell projection assembly	BP
GO:0000086	G2/M transition of mitotic cell cycle	BP
GO:0042676	compound eye cone cell fate commitment	BP
GO:0030718	germ-line stem cell maintenance	BP
GO:0008586	imaginal disc-derived wing vein morphogenesis	BP
GO:0007420	brain development	BP
GO:0007298	border follicle cell migration	BP
GO:0016318	ommatidial rotation	BP
GO:0007482	haltere development	BP
GO:0007391	dorsal closure	BP
GO:0016330	second mitotic wave involved in compound eye morphogenesis	BP
GO:0001742	oenocyte differentiation	BP
GO:0048149	behavioral response to ethanol	BP
GO:0046673	negative regulation of compound eye retinal cell programmed cell death	BP
GO:0005006	epidermal growth factor-activated receptor activity	MF
GO:0045610	regulation of hemocyte differentiation	BP
GO:0007469	antennal development	BP
GO:0008284	positive regulation of cell proliferation	BP
GO:0007310	oocyte dorsal/ventral axis specification	BP
GO:0030381	chorion-containing eggshell pattern formation	BP
GO:0046845	branched duct epithelial cell fate determination, open tracheal system	BP
GO:0003015	heart process	BP
GO:0007431	salivary gland development	BP
GO:0048140	male germ-line cyst encapsulation	BP
GO:0007422	peripheral nervous system development	BP
GO:0008071	maternal determination of dorsal/ventral axis, ovarian follicular epithelium, soma encoded	BP
GO:0045749	negative regulation of S phase of mitotic cell cycle	BP
GO:0045468	regulation of R8 cell spacing in compound eye	BP
GO:0035202	tracheal pit formation in open tracheal system	BP
GO:0016337	cell-cell adhesion	BP
GO:0035277	spiracle morphogenesis, open tracheal system	BP
GO:0007421	stomatogastric nervous system development	BP

Sequence

>gi|257471944|pdb|3I2T|A Chain A, Crystal Structure Of The Unliganded Drosophila Epidermal Growth Factor Receptor Ectodomain
HHHHHHKICIGTKSRLSVPSNKEHHYRNLRDRYTNCTYVDGNLELTWLPNENLDLSFLDNIREVTGYILI
SHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTYSKMYTLEIPDLRDVLNGQVGFHNNYNLCHMRTI
QWSEIVSNGTDAYYNYDFTAPERECPKCHESCTHGCWGEGPKNCQKFSKLTCSPQCAGGRCYGPKPRECC
HLFCAGGCTGPTQKDCIACKNFFDEGVCKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRD
NGACVRSCPQDKMDKGGECVPCNGPCPKTCPGVTVLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYAN
YTMGPRYIPLDPERLEVFSTVKEITGYLNIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKSSLY
SLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNEDGCW
GAGTDQCLNCKNFNFNGTCIADCGYISNAYKFDNRTCKICHPECRTCNGAGADHCQECVHV

Database Cross Reference

Ensembl Gene
UniGene	Dm.20748
PDB	3I2T 3LTG 3LTF
RefSeq	NP_476759.1
Pfam	PF00757 PF01030 PF07714

PTID

epidermal growth factor

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference