cytochrome c

General Information (Source: NCBI Gene,UniProt)

Text mining Term	cytochrome c
UniProt ID	G3E5L6_9NEOP
Name	Cytochrome c oxidase subunit 1
Gene Names	COI
Taxonomy	Thrips palmi

General annotation

Function	Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B (By similarity).
Subcellular location	Mitochondrion inner membrane; Multi-pass membrane protein (By similarity).

Function

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B (By similarity).

Subcellular location

Mitochondrion inner membrane; Multi-pass membrane protein (By similarity).

Sequence

>gi|346229073|gb|AEO21410.1| cytochrome c oxidase subunit I [Thrips palmi]
GLSLSMIIRLNLRTSMKLYVNNDQFYNSIVTAHAFIMIFFTVMPIMIGGFGNWLVPLMLGAPDMAFPRLN
NMSFWLLPPSLTLLIMGLFKEGAGTGWTVYPPLSTFYHSGISVDLTIFSLHLAGISSILGALNFITTIMN
LKNKKLSAEKLSLFVWSVLLTAILLLLSLPVLAGAITMLITDRNLNTSFFDPSGGG

Database Cross Reference

Ensembl Gene
UniGene
PDB
RefSeq
Pfam	PF00115

PTID

cytochrome c

General Information (Source: NCBI Gene,UniProt)

General annotation

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference