Text mining Term | cytochrome P450 (protein family or complex) |
---|---|
UniProt ID | O61656_CERCA |
Name |
Cytochrome P450 monooxygenase |
Gene Names |
|
Taxonomy | Ceratitis capitata |
Function | |
---|---|
Subcellular location |
GO:0009055 | electron carrier activity | MF |
GO:0004497 | monooxygenase activity | MF |
GO:0020037 | heme binding | MF |
GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | MF |
>gi|3044198|gb|AAC13308.1| cytochrome P450 monooxygenase [Ceratitis capitata] MRFGELQASIGIIQLLRNFHFKPCARTKVPLVYAKKNFLIAAEGGIHLMVEKLEKTI |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |