| Text mining Term | protein C |
|---|---|
| UniProt ID | D5MAH2_PEA |
| Name |
Photosystem I iron-sulfur center 1 PsaC 1 Photosystem I subunit VII 1 9 kDa polypeptide 1 PSI-C 1 |
| Gene Names |
psaC
Synonyms:psaC1 |
| Taxonomy | Pisum sativum |
| Function |
Apoprotein for the two 4Fe-4S centers FA and FB of photosystem I (PSI); essential for photochemical activity. FB is the terminal electron acceptor of PSI, donating electrons to ferredoxin. The C-terminus interacts with psaA/B/D and helps assemble the protein into the PSI complex. Required for binding of psaD and psaE to PSI. PSI is a plastocyanin-ferredoxin oxidoreductase, converting photonic excitation into a charge separation, which transfers an electron from the donor P700 chlorophyll pair to the spectroscopically characterized acceptors A0, A1, FX, FA and FB in turn (By similarity). |
|---|---|
| Subcellular location |
Plastid, chloroplast thylakoid membrane; Peripheral membrane protein; Stromal side (By similarity). |
| GO:0009535 | chloroplast thylakoid membrane | CC |
| GO:0006810 | transport | BP |
| GO:0009522 | photosystem I | CC |
| GO:0009773 | photosynthetic electron transport in photosystem I | BP |
| GO:0009055 | electron carrier activity | MF |
| GO:0051539 | 4 iron, 4 sulfur cluster binding | MF |
| GO:0046872 | metal ion binding | MF |
>gi|295136986|ref|YP_003587533.1| photosystem I protein C [Pisum sativum] MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLW HETTRSMGLAY |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq |
YP_003587533.1 |
| Pfam |
PF12838 |