histone H4

General Information (Source: NCBI Gene,UniProt)

Text mining Term	histone H4
UniProt ID	E6R311_CRYGW
Name	Histone H4
Gene Names
Taxonomy	Cryptococcus gattii WM276

General annotation

Function	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling (By similarity).
Subcellular location

Function

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling (By similarity).

Subcellular location

Gene Ontology

GO:0005634	nucleus	CC
GO:0003677	DNA binding	MF
GO:0000786	nucleosome	CC
GO:0006334	nucleosome assembly	BP

Sequence

>gi|321255130|ref|XP_003193318.1| histone H4 [Cryptococcus gattii WM276]
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDS
VTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGA

Database Cross Reference

Ensembl Gene
UniGene
PDB
RefSeq	XP_003193318.1 XP_003192698.1
Pfam	PF00125

PTID

histone H4

General Information (Source: NCBI Gene,UniProt)

General annotation

Gene Ontology

Sequence

Options for BLAST

Database:

Set subsequence:(optional):

Optional parameters:

Database Cross Reference