| Text mining Term | homeobox |
|---|---|
| UniProt ID | Q8WTG9_9ORTH |
| Name |
Engrailed |
| Gene Names |
en
|
| Taxonomy | Melanoplus sp. MFW-2001 |
| Function | |
|---|---|
| Subcellular location |
Nucleus (By similarity). ----------------------------------------------------------------------- Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License ----------------------------------------------------------------------- |
| GO:0043565 | sequence-specific DNA binding | MF |
| GO:0003700 | sequence-specific DNA binding transcription factor activity | MF |
| GO:0005634 | nucleus | CC |
>gi|17063327|gb|AAL35002.1| engrailed [Melanoplus sp. MFW-2001] EKRPRTAFSGEQLARLKHEFTENRYLTERRRQELARELGLNEAQI |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq | |
| Pfam |
PF00046 |