Text mining Term | homeobox |
---|---|
UniProt ID | Q8WTG9_9ORTH |
Name |
Engrailed |
Gene Names |
en
|
Taxonomy | Melanoplus sp. MFW-2001 |
Function | |
---|---|
Subcellular location |
Nucleus (By similarity). ----------------------------------------------------------------------- Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License ----------------------------------------------------------------------- |
GO:0005634 | nucleus | CC |
GO:0003700 | sequence-specific DNA binding transcription factor activity | MF |
GO:0043565 | sequence-specific DNA binding | MF |
>gi|17063327|gb|AAL35002.1| engrailed [Melanoplus sp. MFW-2001] EKRPRTAFSGEQLARLKHEFTENRYLTERRRQELARELGLNEAQI |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |
PF00046 |