| Text mining Term | frataxin |
|---|---|
| UniProt ID | FRDA_SCHPO |
| Name |
Frataxin homolog, mitochondrial |
| Gene Names |
|
| Taxonomy | Schizosaccharomyces pombe 972h- |
| Function |
Promotes the biosynthesis of heme as well as the assembly and repair of iron-sulfur clusters by delivering Fe(2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe(2+) to Fe(3+). May be able to store large amounts of the metal in the form of a ferrihydrite mineral by oligomerization (By similarity). |
|---|---|
| Subcellular location |
Mitochondrion (By similarity). |
| GO:0006879 | cellular iron ion homeostasis | BP |
| GO:0005759 | mitochondrial matrix | CC |
| GO:0006811 | ion transport | BP |
| GO:0004322 | ferroxidase activity | MF |
| GO:0030234 | enzyme regulator activity | MF |
| GO:0072592 | oxygen metabolic process | BP |
| GO:0018283 | iron incorporation into metallo-sulfur cluster | BP |
| GO:0006783 | heme biosynthetic process | BP |
| GO:0005506 | iron ion binding | MF |
>gi|19075386|ref|NP_587886.1| frataxin [Schizosaccharomyces pombe 972h-] MQSLRAAFRRRTPIFLKPYEFSTNVFGLRCRYYSQVRHNGALTDLEYHRVADDTLDVLNDTFEDLLEEVG KKDYDIQYANGVITLMLGEKGTYVINKQPPAHQIWLSSPVSGPKHYEYSLKSKTWCSTRDEGTLLGILSS EFSKWFSRPIEFKKSEDF |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq |
NP_587886.1 |
| Pfam |
PF01491 |