ATPase

General Information (Source: NCBI Gene,UniProt)

Text mining Term ATPase
UniProt ID ATPH_AGRST
Name F-type ATPase subunit c
Lipid-binding protein
ATP synthase F(0) sector subunit c
ATP synthase subunit c, chloroplastic
F-ATPase subunit c
ATPase subunit III
Gene Names atpH
Taxonomy Agrostis stolonifera

General annotation

Function F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (By similarity). Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits (By similarity).
Subcellular location Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein (By similarity).

Gene Ontology

GO:0015991 ATP hydrolysis coupled proton transport BP
GO:0016021 integral to membrane CC
GO:0015986 ATP synthesis coupled proton transport BP
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o) CC
GO:0015078 hydrogen ion transmembrane transporter activity MF
GO:0008289 lipid binding MF
GO:0009535 chloroplast thylakoid membrane CC

Sequence

>gi|223635044|sp|A1EA03.1|ATPH_AGRST RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein
MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVV
ALALLFANPFV

Options for BLAST

Database:

Set subsequence:(optional):

From: To:

Optional parameters:

Expect:
Descriptions:

Database Cross Reference

Ensembl Gene
UniGene
PDB
RefSeq YP_874731.1
Pfam PF00137