Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
HSP32 Heme oxygenase 1 HO-1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0005730 | nucleolus | CC |
GO:0031670 | cellular response to nutrient | BP |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0020037 | heme binding | MF |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0001525 | angiogenesis | BP |
GO:0006644 | phospholipid metabolic process | BP |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0005901 | caveola | CC |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0006788 | heme oxidation | BP |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0004630 | phospholipase D activity | MF |
GO:0005829 | cytosol | CC |
GO:0005792 | microsome | CC |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0043627 | response to estrogen stimulus | BP |
GO:0008219 | cell death | BP |
GO:0042167 | heme catabolic process | BP |
GO:0008217 | regulation of blood pressure | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0019899 | enzyme binding | MF |
GO:0001666 | response to hypoxia | BP |
GO:0042542 | response to hydrogen peroxide | BP |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1IX3 2ZVU 1ULX 2E7E 3I9T 1VGI 1DVE 1J02 1IRM 1IVJ 1IX4 3I9U 1DVG 1UBB 2DY5 1J2C |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |