Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
Heme oxygenase 1 HSP32 HO-1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0006788 | heme oxidation | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0006644 | phospholipid metabolic process | BP |
GO:0008219 | cell death | BP |
GO:0020037 | heme binding | MF |
GO:0005730 | nucleolus | CC |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0001666 | response to hypoxia | BP |
GO:0031670 | cellular response to nutrient | BP |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0005829 | cytosol | CC |
GO:0008217 | regulation of blood pressure | BP |
GO:0004630 | phospholipase D activity | MF |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0001525 | angiogenesis | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0005901 | caveola | CC |
GO:0042167 | heme catabolic process | BP |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0019899 | enzyme binding | MF |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0005792 | microsome | CC |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
3I9U 2E7E 1IX3 1IRM 1ULX 1IX4 2DY5 1DVG 1DVE 1IVJ 1VGI 1J2C 2ZVU 3I9T 1J02 1UBB |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |