Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
HSP32 HO-1 Heme oxygenase 1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0001525 | angiogenesis | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0019899 | enzyme binding | MF |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0005901 | caveola | CC |
GO:0043627 | response to estrogen stimulus | BP |
GO:0020037 | heme binding | MF |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0008217 | regulation of blood pressure | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0006644 | phospholipid metabolic process | BP |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0008219 | cell death | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0005792 | microsome | CC |
GO:0042167 | heme catabolic process | BP |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0004630 | phospholipase D activity | MF |
GO:0005730 | nucleolus | CC |
GO:0001666 | response to hypoxia | BP |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0006788 | heme oxidation | BP |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0031670 | cellular response to nutrient | BP |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0005829 | cytosol | CC |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1IRM 1J2C 1ULX 2DY5 1DVG 3I9T 1J02 1IX4 1DVE 1IX3 1UBB 3I9U 2ZVU 1IVJ 1VGI 2E7E |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |