Text mining Term | heme oxygenase 1 |
---|---|
UniProt ID | HMOX1_RAT |
Name |
Heme oxygenase 1 HSP32 HO-1 |
Gene Names |
Hmox1
|
Taxonomy | Rattus norvegicus |
Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. |
---|---|
Subcellular location |
Microsome. Endoplasmic reticulum. |
GO:0045768 | positive regulation of anti-apoptosis | BP |
GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | BP |
GO:0031670 | cellular response to nutrient | BP |
GO:0005730 | nucleolus | CC |
GO:0032764 | negative regulation of mast cell cytokine production | BP |
GO:0007264 | small GTPase mediated signal transduction | BP |
GO:0048662 | negative regulation of smooth muscle cell proliferation | BP |
GO:0004392 | heme oxygenase (decyclizing) activity | MF |
GO:0019899 | enzyme binding | MF |
GO:0042167 | heme catabolic process | BP |
GO:0006644 | phospholipid metabolic process | BP |
GO:0004630 | phospholipase D activity | MF |
GO:0042542 | response to hydrogen peroxide | BP |
GO:0006788 | heme oxidation | BP |
GO:0005829 | cytosol | CC |
GO:0020037 | heme binding | MF |
GO:0043524 | negative regulation of neuron apoptosis | BP |
GO:0043392 | negative regulation of DNA binding | BP |
GO:0008630 | DNA damage response, signal transduction resulting in induction of apoptosis | BP |
GO:0043627 | response to estrogen stimulus | BP |
GO:0001666 | response to hypoxia | BP |
GO:0005901 | caveola | CC |
GO:0043305 | negative regulation of mast cell degranulation | BP |
GO:0045766 | positive regulation of angiogenesis | BP |
GO:0005792 | microsome | CC |
GO:0043433 | negative regulation of sequence-specific DNA binding transcription factor activity | BP |
GO:0008219 | cell death | BP |
GO:0001525 | angiogenesis | BP |
GO:0005783 | endoplasmic reticulum | CC |
GO:0008217 | regulation of blood pressure | BP |
>gi|6981032|ref|NP_036712.1| heme oxygenase 1 [Rattus norvegicus] MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLA TVAVGIYAM |
Ensembl Gene |
ENSRNOT00000019192 |
---|---|
UniGene |
Rn.3160 |
PDB |
1DVE 3I9U 1IX3 2ZVU 1UBB 1IVJ 2E7E 1J2C 1VGI 1IX4 3I9T 1DVG 2DY5 1IRM 1ULX 1J02 |
RefSeq |
NP_036712.1 |
Pfam |
PF01126 |