P23

General Information (Source: NCBI Gene,UniProt)

Text mining Term P23
UniProt ID CD5R1_RAT
Name p25
Tau protein kinase II 23 kDa subunit
Cyclin-dependent kinase 5 activator 1, p25
p23
Cyclin-dependent kinase 5 regulatory subunit 1
CDK5 activator 1
Cyclin-dependent kinase 5 activator 1
Cyclin-dependent kinase 5 activator 1, p35
TPKII regulatory subunit
p35
Gene Names Cdk5r1
Synonyms:Cdk5r
Taxonomy Rattus norvegicus

General annotation

Function p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII.
Subcellular location Cyclin-dependent kinase 5 activator 1, p35: Cell membrane; Lipid-anchor; Cytoplasmic side (By similarity). Cyclin-dependent kinase 5 activator 1, p25: Nucleus (By similarity). Cytoplasm, perinuclear region (By similarity). Note=The conversion of p35 to p25 relocalizes the protein from the cell periphery to the cytoplasm, in nuclear and perinuclear regions (By similarity).

Gene Ontology

GO:0007213 G-protein coupled acetylcholine receptor signaling pathway BP
GO:0004693 cyclin-dependent protein kinase activity MF
GO:0048471 perinuclear region of cytoplasm CC
GO:0043025 neuronal cell body CC
GO:0016534 cyclin-dependent protein kinase 5 activator activity MF
GO:0007411 axon guidance BP
GO:0007158 neuron cell-cell adhesion BP
GO:0030426 growth cone CC
GO:0007413 axonal fasciculation BP
GO:0009790 embryo development BP
GO:0043292 contractile fiber CC
GO:0016533 cyclin-dependent protein kinase 5 holoenzyme complex CC
GO:0043525 positive regulation of neuron apoptosis BP
GO:0005886 plasma membrane CC
GO:0046875 ephrin receptor binding MF
GO:0031594 neuromuscular junction CC
GO:0045296 cadherin binding MF
GO:0035235 ionotropic glutamate receptor signaling pathway BP
GO:0030424 axon CC
GO:0014069 postsynaptic density CC
GO:0005509 calcium ion binding MF
GO:0061001 regulation of dendritic spine morphogenesis BP
GO:0048013 ephrin receptor signaling pathway BP
GO:0048675 axon extension BP
GO:0001764 neuron migration BP

Sequence

>gi|16758762|ref|NP_446343.1| cyclin-dependent kinase 5 activator 1 [Rattus norvegicus]
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKAQP
NSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGVSSSVKKAPHPAITSAGTPK
RVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRD
VISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPH
YFTQVFSDLKNESGQEDKKRLLLGLDR

Options for BLAST

Database:

Set subsequence:(optional):
From: To:

Optional parameters:
Expect:
Descriptions:

Database Cross Reference

Ensembl Gene ENSRNOT00000031746
UniGene Rn.11213
PDB
RefSeq NP_446343.1
Pfam PF03261