| Text mining Term | mitochondrial ATPase |
|---|---|
| UniProt ID | ATP9_HELAN |
| Name |
ATP synthase subunit 9, mitochondrial Lipid-binding protein |
| Gene Names |
ATP9
|
| Taxonomy | Helianthus annuus |
| Function |
This protein is one of the chains of the nonenzymatic membrane component (F0) of mitochondrial ATPase. |
|---|---|
| Subcellular location |
Mitochondrion membrane; Multi-pass membrane protein (Potential). |
| GO:0016021 | integral to membrane | CC |
| GO:0005524 | ATP binding | MF |
| GO:0015986 | ATP synthesis coupled proton transport | BP |
| GO:0015991 | ATP hydrolysis coupled proton transport | BP |
| GO:0045263 | proton-transporting ATP synthase complex, coupling factor F(o) | CC |
| GO:0008289 | lipid binding | MF |
| GO:0015078 | hydrogen ion transmembrane transporter activity | MF |
| GO:0031966 | mitochondrial membrane | CC |
>gi|1352023|sp|P17254.2|ATP9_HELAN RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein MLEGAKSIGAGAATIASAGAAIGIGNVLSSSIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI SSVIPIKESKKEG |
| Ensembl Gene | |
|---|---|
| UniGene | |
| PDB | |
| RefSeq | |
| Pfam |
PF00137 |