Text mining Term | mitochondrial ATPase |
---|---|
UniProt ID | ATP9_HELAN |
Name |
Lipid-binding protein ATP synthase subunit 9, mitochondrial |
Gene Names |
ATP9
|
Taxonomy | Helianthus annuus |
Function |
This protein is one of the chains of the nonenzymatic membrane component (F0) of mitochondrial ATPase. |
---|---|
Subcellular location |
Mitochondrion membrane; Multi-pass membrane protein (Potential). |
GO:0015991 | ATP hydrolysis coupled proton transport | BP |
GO:0045263 | proton-transporting ATP synthase complex, coupling factor F(o) | CC |
GO:0015986 | ATP synthesis coupled proton transport | BP |
GO:0015078 | hydrogen ion transmembrane transporter activity | MF |
GO:0016021 | integral to membrane | CC |
GO:0008289 | lipid binding | MF |
GO:0031966 | mitochondrial membrane | CC |
GO:0005524 | ATP binding | MF |
>gi|1352023|sp|P17254.2|ATP9_HELAN RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein MLEGAKSIGAGAATIASAGAAIGIGNVLSSSIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI SSVIPIKESKKEG |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |
PF00137 |