Text mining Term | muscles |
---|---|
UniProt ID | AKH2_SCHGR |
Name |
Adipokinetic hormone II APRP-beta Adipokinetic hormone 2 Adipokinetic prohormone type 2 Adipokinetic hormone precursor-related peptide beta chain AKH-II |
Gene Names |
|
Taxonomy | Schistocerca gregaria |
Function |
This hormone, released from cells in the corpora cardiaca after the beginning of flight, causes release of diglycerides from the fat body and then stimulates the flight muscles to use these diglycerides as an energy source. |
---|---|
Subcellular location |
Secreted. |
GO:0007629 | flight behavior | BP |
GO:0005576 | extracellular region | CC |
GO:0005179 | hormone activity | MF |
GO:0007218 | neuropeptide signaling pathway | BP |
>gi|543790|sp|P35808.1|AKH2_SCHGR RecName: Full=Adipokinetic prohormone type 2; Contains: RecName: Full=Adipokinetic hormone 2; AltName: Full=Adipokinetic hormone II; Short=AKH-II; Contains: RecName: Full=Adipokinetic hormone precursor-related peptide beta chain; Short=APRP-beta; Flags: Precursor QLNFSTGWGRRYADPNADPMAFLTKLIQIEARKLSGCSN |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |
PF06377 |