Text mining Term | muscles |
---|---|
UniProt ID | AKH2_SCHGR |
Name |
Adipokinetic hormone II APRP-beta Adipokinetic prohormone type 2 AKH-II Adipokinetic hormone 2 Adipokinetic hormone precursor-related peptide beta chain |
Gene Names |
|
Taxonomy | Schistocerca gregaria |
Function |
This hormone, released from cells in the corpora cardiaca after the beginning of flight, causes release of diglycerides from the fat body and then stimulates the flight muscles to use these diglycerides as an energy source. |
---|---|
Subcellular location |
Secreted. |
GO:0005179 | hormone activity | MF |
GO:0007629 | flight behavior | BP |
GO:0005576 | extracellular region | CC |
GO:0007218 | neuropeptide signaling pathway | BP |
>gi|543790|sp|P35808.1|AKH2_SCHGR RecName: Full=Adipokinetic prohormone type 2; Contains: RecName: Full=Adipokinetic hormone 2; AltName: Full=Adipokinetic hormone II; Short=AKH-II; Contains: RecName: Full=Adipokinetic hormone precursor-related peptide beta chain; Short=APRP-beta; Flags: Precursor QLNFSTGWGRRYADPNADPMAFLTKLIQIEARKLSGCSN |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |
PF06377 |