Text mining Term | protein tyrosine kinase |
---|---|
UniProt ID | ROR1_DROME |
Name |
dRor Tyrosine-protein kinase transmembrane receptor Ror |
Gene Names |
Ror
|
Taxonomy | Drosophila melanogaster |
Function |
Tyrosine-protein kinase receptor that functions during early stages of neuronal development. |
---|---|
Subcellular location |
Membrane; Single-pass type I membrane protein (Potential). |
GO:0007169 | transmembrane receptor protein tyrosine kinase signaling pathway | BP |
GO:0004714 | transmembrane receptor protein tyrosine kinase activity | MF |
GO:0007417 | central nervous system development | BP |
GO:0005524 | ATP binding | MF |
GO:0016021 | integral to membrane | CC |
>gi|2648036|emb|CAA05743.1| protein tyrosine kinase [Drosophila melanogaster] CLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMPSESILYGKFTTES |
Ensembl Gene | |
---|---|
UniGene |
Dm.4808 |
PDB | |
RefSeq |
NP_476962.1 |
Pfam |
PF00051 PF07714 |