Text mining Term | polymerases |
---|---|
UniProt ID | RPAB5_BRANA |
Name |
DNA-directed RNA polymerases I, II, and III subunit RPABC5 DNA-directed RNA polymerase III subunit L ABC10 RPB10 homolog RNA polymerases I, II, and III subunit ABC5 |
Gene Names |
|
Taxonomy | Brassica napus |
Function |
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RBP10 is part of the core element with the central large cleft (By similarity). |
---|---|
Subcellular location |
Nucleus (By similarity). |
GO:0003677 | DNA binding | MF |
GO:0008270 | zinc ion binding | MF |
GO:0006355 | regulation of transcription, DNA-dependent | BP |
GO:0005634 | nucleus | CC |
GO:0003899 | DNA-directed RNA polymerase activity | MF |
>gi|2833375|sp|Q39290.1|RPAB5_BRANA RecName: Full=DNA-directed RNA polymerases I, II, and III subunit RPABC5; Short=RNA polymerases I, II, and III subunit ABC5; AltName: Full=ABC10; AltName: Full=DNA-directed RNA polymerase III subunit L; AltName: Full=RPB10 homolog MIIPVRCFTCGKVIGNKWDAYLDLLQLDYTEGDALDALNLVRYCCRRMLMTHVDLIEKLLNYNTLEKSDN S |
Ensembl Gene | |
---|---|
UniGene | |
PDB | |
RefSeq | |
Pfam |
PF01194 |